Recombinant Mouse C5a anaphylatoxin chemotactic receptor(C5ar1)

Code CSB-CF003996MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P30993
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVW VTAFEARRAVNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFDATACIVLPSLILLNM YASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKD FYSEHTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKATRSTK TLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPII YVMAGQGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
Source in vitro E.coli expression system
Gene Names C5ar1
Protein Names Recommended name: C5a anaphylatoxin chemotactic receptor Short name= C5a-R Short name= C5aRAlternative name(s): CD_antigen= CD88
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:12273

STRING: 10090.ENSMUSP00000060003

UniGene: Mm.247623

Pathway Complement and coagulation cascades

Related Products

C5ar1 Proteins

C5ar1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.