Recombinant Mouse Furin (Furin)

Code CSB-CF009068MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Furin
Uniprot No.
Alternative Names
Furin; Fur; Pcsk3; Furin; Dibasic-processing enzyme; Paired basic amino acid residue-cleaving enzyme; PACE; Prohormone convertase 3
Species
Mus musculus (Mouse)
Expression Region
108-793
Target Protein Sequence
DVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNY DPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRML DGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGS IFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLN ADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEV RKAVTACLGEPNHITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADG FNDWAFMTTHSWDEDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGC KTLTSSQACVVCEEGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEIIRASVCTPCHAS CATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQAG LASHLPEVLAGLSCLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDRGLISYKGLPPEAWQ EECPSDSEEDEGRGERTAFIKDQSAL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitous endoprotease within constitutive secretory pathways capable of cleavage at the RX(K/R)R consensus motif. Mediates processing of TGFB1, an essential step in TGF-beta-1 activation. Converts through proteolytic cleavage the non-functional Brain natriuretic factor prohormone into its active hormone BNP(1-45).
Gene References into Functions
  1. The developmental arrest of early secondary follicles following furin disruption might be rooted in the loss of the mature form of ADAMTS1 and compromised proliferation of granulosa cells in mutant mice. PMID: 28569793
  2. FURIN has an anti-inflammatory function in LysM+ myeloid cells in vivo. PMID: 27527873
  3. The proprotein convertase furin is responsible for pro-OCN maturation in vitro and in vivo. PMID: 28972540
  4. Furin plays an important role in the malignant phenotype of rhabdomyosarcoma cells by activating proteins involved in tumor growth, vascularization, metastasis and invasion. PMID: 27548722
  5. Studied the impact of Furin inhibition on the development and progression of hepatocellular carcinoma. PMID: 26167473
  6. PC7 and the related proteases Furin and Pace4 regulate E-cadherin function during blastocyst formation. PMID: 26416966
  7. work confirms the hypothesis that the TCR-regulated protease FURIN plays an important role in T cell activation and that it can specifically modulate TCR-activated transactivation PMID: 25926688
  8. the role of serpinB8/furin in obesity-associated chronic inflammation PMID: 23936445
  9. overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner PMID: 23686857
  10. we observed an increased susceptibility to UV in single furin transgenic mice that was not substantially enhanced in the double furin/PACE4 transgenic mice. PMID: 23441131
  11. These data suggest that obesity states facilitate the cleavage of adipolin presumably through upregulation of furin in adipose tissue. PMID: 23068097
  12. An endothelial cell-specific knockout mice of the Furin gene was generated. This resulted in postnatal lethality, likely due to heart ventricular septal and/or valve defects. PMID: 22733989
  13. Furin and Pace4 are released by the extraembryonic microenvironment, and that they cleave a membrane-bound reporter substrate in adjacent epiblast cells and activate Nodal to maintain pluripotency PMID: 21896659
  14. Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10. PMID: 21550985
  15. in hepatocytes furin regulates PCSK9 mRNA levels and is the key in vivo-inactivating protease of circulating PCSK9. PMID: 21147780
  16. transferrin receptor 2 and HFE are involved in holotransferrin-dependent signaling for the regulation of furin which involved Erk phosphorylation. Furin in turn may control hepcidin expression. PMID: 20634490
  17. Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase PMID: 11861638
  18. Spc1 regulates Nodal signalling during gastrulation PMID: 12447384
  19. the proprotein convertase furin in mouse liver has limited redundancy PMID: 15471862
  20. furin enhances alpha-secretase activity via the cleavage of ADAM10 and TACE, and attenuated furin activity is connected to the production of Abeta PMID: 16942750
  21. insensitivity of both forms of TGF-beta 2 to furin is a consequence of the tertiary structure of their LAP regions rather than their cleavage site PMID: 17516499
  22. s-HJV originates from a furin cleavage at position 332-335 PMID: 17938254
  23. PC furin is a major IGF-1 receptor convertase. PMID: 18064302
  24. Suggest an important role for furin in PLAG1-induced salivary gland tumorigenesis in mice. PMID: 18425334
  25. furin is indispensable in maintaining peripheral tolerance, which is due, at least in part, to its non-redundant, essential function in regulating TGF-beta1 production PMID: 18701887
  26. Expression of PCSK3 in mouse small intestine. PMID: 18706454
  27. role for furin in regulated secretion, particularly in intragranular acidification most likely due to impaired processing of Ac45 PMID: 18713856
  28. Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin. PMID: 19056739
  29. The furin-mediated secretory pathway of antigen processing has the potential to generate in vivo a compensatory and effective CD8-positive T lymphocyte response in ATP-binding transporter (TAP)1-deficient mice. PMID: 19752221

Show More

Hide All

Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Secreted. Endosome membrane; Single-pass type I membrane protein.
Protein Families
Peptidase S8 family, Furin subfamily
Tissue Specificity
Seems to be expressed ubiquitously.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1