Recombinant Rat Potassium channel subfamily K member 10(Kcnk10)

Code CSB-CF862371RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JIS4
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MKFPIETPRKQVNWDPKVAVPAAAPPVCQPKSATNGHHPVPRLSISSRATVVARMEGASQ GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHICVS PQELETLIQHALDADNAGVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP NNLRLKGPEQLNKHGQGASEDNIINKFGSTSKLTKRKNKDLKKTLPEDVQKIYKTFRNYS LDEEKKEDETEKMCNSDNSSTAMLTECIQQQAEMENGMVPMDTKDQGLENNSLLEDRN
Source in vitro E.coli expression system
Gene Names Kcnk10
Protein Names Recommended name: Potassium channel subfamily K member 10 Alternative name(s): Outward rectifying potassium channel protein TREK-2 TREK-2 K(+) channel subunit
Expression Region 1-538
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Expressed mainly in the cerebellum, spleen, and testis.
Database Links

KEGG: rno:65272

STRING: 10116.ENSRNOP00000005175

UniGene: Rn.53999

Related Products

Kcnk10 Proteins

Kcnk10 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.