Recombinant Human C-X-C motif chemokine 14(CXCL14)

In Stock
Code CSB-AP003521HU
Product Type Chemokine
Size US$153
Uniprot No. O95715
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 1 M NaCl, pH 8.5
Alias C-X-C Motif Chemokine 14; Chemokine BRAKm MIP-2G; Small-Inducible Cytokine B14; CXCL14; MIP2G; NJAC; SCYB14
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells is typically 1-10 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Research Area Immunology
Source E.coli
Gene Names CXCL14
Expression Region 35-111aa
Tag Info Tag-Free
Mol. Weight 9.4 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Tissue Specificity Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. N
Database Links

HGNC: 10640

OMIM: 604186

KEGG: hsa:9547

STRING: 9606.ENSP00000337065

UniGene: Hs.483444

Pathway Chemokine signaling pathway

Related Products

CXCL14 Antibodies

CXCL14 Antibodies for Homo sapiens (Human)

CXCL14 Antibodies for Human

CXCL14 Proteins

CXCL14 Proteins for Homo sapiens (Human)

CXCL14 ELISA Kit

CXCL14 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.