Name: Recombinant Human Interleukin-23(IL-23) (Active)
Brand: CUSABIO
SKU: CSB-AP004661HU

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 70-210 ng/ml.
Target Names	IL23A
Uniprot No.	Q9NPF7&P29460
Research Area	Immunology
Alternative Names	IL 23 A; IL 23; IL 23 subunit alpha; IL 23A; IL 23p19; IL-23 subunit alpha; IL-23-A; IL-23p19; IL12B; IL23; Il23a; IL23A_HUMAN; IL23P19; interleukin 12B; Interleukin 23 alpha subunit p19; Interleukin 23 p19 subunit; interleukin 23 subunit alpha; interleukin 23 subunit p19; interleukin six; G CSF related factor; Interleukin-23 subunit alpha; Interleukin-23 subunit p19; JKA3 induced upon T cell activation; MGC79388; P19; SGRF
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	20-189aa & 23-328aa
Complete Sequence	RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Mol. Weight	19.5kDa&35.5kDa
Protein Length	Heterodimer
Tag Info	C-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered solution of PBS,100mM NaCl, pH 7.4
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA	Please contact us to get it.

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP004661HU
Size	US$3564Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-23(IL-23) (Active)

Product Details

Customer Reviews and Q&A

CloseMessage

×CloseMessage