Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004661HU |
| Product Type | Interleukin |
| Size | US$195 |
| Uniprot No. | Q9NPF7 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20 ug/ml |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | IL-23 |
| Expression Region | 20-189aa & 23-328aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 54.4 kDa |
| Protein Description | Heterodimer |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. |
| Subcellular Location | Secreted |
| Protein Families | IL-6 superfamily |
| Tissue Specificity | Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). |
| Database Links |
HGNC: 15488 OMIM: 605580 KEGG: hsa:51561 STRING: 9606.ENSP00000228534 UniGene: Hs.382212 |
| Pathway |
Jak-STAT signaling pathway
Th17 cell differentiation |
IL-23 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA06719A0Rb | IL23A Antibody | Human | ELISA, IHC, IF |
IL-23 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA06719B0Rb | IL23A Antibody, HRP conjugated | Human | ELISA |
| CSB-PA06719C0Rb | IL23A Antibody, FITC conjugated | Human | ELISA |
| CSB-PA06719D0Rb | IL23A Antibody, Biotin conjugated | Human | ELISA |
IL-23 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP868278HU CSB-EP868278HU CSB-BP868278HU CSB-MP868278HU |
Recombinant Human Interleukin-23 subunit alpha(IL23A) | Yeast E.coli Baculovirus Mammalian cell |
IL-23 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E17339h | Human Interleukin-23 subunit alpha(IL-23A) Elisa kit | serum, plasma, cell culture supernates, tissue homogenates, cell lysates | 15.6 pg/mL |
Recombinant Mouse Ornithine carbamoyltransferase, mitochondrial(Otc)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rabbit Apolipoprotein E(APOE),partial
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Rat Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Ras-related protein Rab-4A(RAB4A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Macaca mulatta Interleukin-15(IL15)
Express system: Yeast
Species: Macaca mulatta (Rhesus macaque)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.