Recombinant Human Interleukin-23(IL-23)

In Stock
Code CSB-AP004661HU
Product Type Interleukin
Size US$195
Uniprot No. Q9NPF7
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20 ug/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Research Area Immunology
Source Mammalian cell
Gene Names IL-23
Expression Region 20-189aa & 23-328aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 54.4 kDa
Protein Description Heterodimer
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular Location Secreted
Protein Families IL-6 superfamily
Tissue Specificity Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
Database Links

HGNC: 15488

OMIM: 605580

KEGG: hsa:51561

STRING: 9606.ENSP00000228534

UniGene: Hs.382212

Pathway Jak-STAT signaling pathway
Th17 cell differentiation

Related Products

IL-23 Antibodies

IL-23 Antibodies for Human

IL-23 Antibodies for Homo sapiens (Human)

IL-23 Proteins

IL-23 Proteins for Homo sapiens (Human)

IL-23 ELISA Kit

IL-23 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.