Recombinant Human Interleukin-23(IL-23) (Active)

In Stock
Code CSB-AP004661HU
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20 ug/ml
Target Names IL23A
Uniprot No. Q9NPF7&P29460
Research Area Immunology
Alternative Names IL 23 A; IL 23; IL 23 subunit alpha; IL 23A; IL 23p19; IL-23 subunit alpha; IL-23-A; IL-23p19; IL12B; IL23; Il23a; IL23A_HUMAN; IL23P19; interleukin 12B; Interleukin 23 alpha subunit p19; Interleukin 23 p19 subunit; interleukin 23 subunit alpha; interleukin 23 subunit p19; interleukin six; G CSF related factor; Interleukin-23 subunit alpha; Interleukin-23 subunit p19; JKA3 induced upon T cell activation; MGC79388; P19; SGRF
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 20-189aa & 23-328aa
Complete Sequence RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Mol. Weight 19.5kDa&35.5kDa
Protein Length Heterodimer
Tag Info C-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1