Recombinant Human Interleukin-23(IL-23) (Active)

In Stock
Code CSB-AP004661HU
Product Type Interleukin
Size US$195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q9NPF7
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to binding IL23RA used funtional ELISA is less than 20 ug/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Research Area Immunology
Source Mammalian cell
Gene Names IL-23
Expression Region 20-189aa & 23-328aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 54.4 kDa
Protein Description Heterodimer
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular Location Secreted
Protein Families IL-6 superfamily
Tissue Specificity Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
Database Links

HGNC: 15488

OMIM: 605580

KEGG: hsa:51561

STRING: 9606.ENSP00000228534

UniGene: Hs.382212

Pathway Jak-STAT signaling pathway
Th17 cell differentiation

Related Products

IL-23 Antibodies

IL-23 Antibodies for Human

IL-23 Antibodies for Homo sapiens (Human)

IL-23 Proteins

IL-23 Proteins for Homo sapiens (Human)

IL-23 ELISA Kit

IL-23 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.