Recombinant Human Duffy antigen/chemokine receptor(DARC)

Code CSB-CF624105HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q16570
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS ALP
Source in vitro E.coli expression system
Gene Names DARCSynonyms:FY,,GPD
Protein Names Recommended name: Duffy antigen/chemokine receptorAlternative name(s): Fy glycoprotein Short name= GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen= CD234
Expression Region 1-63
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms
Subcellular Location Early endosome, Recycling endosome, Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues exp
Database Links

HGNC: 4035

OMIM: 110700

KEGG: hsa:2532

STRING: 9606.ENSP00000357103

UniGene: Hs.153381

Related Products

DARCSynonyms:FY,,GPD Antibodies

DARCSynonyms:FY,,GPD Antibodies for Human

DARCSynonyms:FY,,GPD Antibodies for Homo sapiens (Human)

DARCSynonyms:FY,,GPD Proteins

DARCSynonyms:FY,,GPD Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.