Recombinant Human Chemokine-binding protein 2(CCBP2)

Code CSB-CF004618HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00590
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLG LSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMV STLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDM VFVQTHENPKGVWNCHADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRL RPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESI AFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMT GMNDLGERQSENYPNKEDVGNKSA
Source in vitro E.coli expression system
Gene Names CCBP2Synonyms:CCR10,,CMKBR9
Protein Names Recommended name: Chemokine-binding protein 2 Alternative name(s): C-C chemokine receptor D6 Chemokine receptor CCR-10 Chemokine receptor CCR-9 Chemokine-binding protein D6
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3. Upon active ligand stimulation, activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling pathway. Activation of this pathway results in up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in placenta, plays an essential role in the resolution (termination) of the inflammatory response and in the regulation of adaptive immune responses. Plays a major role in the immune silencing of macrophages during the resolution of inflammation. Acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is required for immature/mature dendritic cells discrimination by LECs.
Subcellular Location Early endosome, Recycling endosome, Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity Found in endothelial cells lining afferent lymphatics in dermis and lymph nodes. Also found in lymph nodes subcapsular and medullary sinuses, tonsillar lymphatic sinuses and lymphatics in mucosa and submucosa of small and large intestine and appendix. Als
Database Links

HGNC: 1565

OMIM: 602648

KEGG: hsa:1238

STRING: 9606.ENSP00000273145

UniGene: Hs.146346

Related Products

CCBP2Synonyms:CCR10,,CMKBR9 Antibodies

CCBP2Synonyms:CCR10,,CMKBR9 Antibodies for Homo sapiens (Human)

CCBP2Synonyms:CCR10,,CMKBR9 Proteins

CCBP2Synonyms:CCR10,,CMKBR9 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.