CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-MP733578HU |
Size | US$298 |
Image |
|
The Latest Promotion | ![]() |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 93% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. |
Target Names | CD276 |
Uniprot No. | Q5ZPR3 |
Research Area | Cancer |
Alternative Names | 4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 29-245aa |
Target Protein Sequence | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG |
Mol. Weight | 53.4 kDa |
Protein Length | Partial |
Tag Info |
C-terminal FC-Myc-tagged |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling. |
Gene References into Functions |
|
Subcellular Location | Membrane, Single-pass type I membrane protein |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Tissue Specificity | Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophob |
Database Links |
HGNC: 19137 OMIM: 605715 KEGG: hsa:80381 STRING: 9606.ENSP00000320084 UniGene: Hs.744915 |