Recombinant Human CD276 antigen(CD276),partial (Active)

In Stock
Code CSB-MP733578HU
Size US$298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. Biological Activity Assay
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 93% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.
Target Names CD276
Uniprot No. Q5ZPR3
Research Area Cancer
Alternative Names 4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 29-245aa
Target Protein Sequence LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
Mol. Weight 53.4 kDa
Protein Length Partial
Tag Info C-terminal FC-Myc-tagged
Form Liquid or Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.
Gene References into Functions
  1. High B7-H3 expression is associated with phyllodes tumors. PMID: 30486739
  2. characterization of the expression pattern and biological function of B7-H3 in brain gliomas; B7-H3 expression is regulated by multiple mechanisms and is potentially involved in the T-cell receptor signaling pathway; higher B7-H3 expression indicates a worse prognosis for glioma patients PMID: 30027617
  3. High expression level of B7H3 in muscleinvasive bladder cancer (MIBC) tissues is associated with a poor clinico-pathological status and poor prognosis, and promotes the development of MIBC in vitro and in vivo. PMID: 30132557
  4. Tumor B7-H3 expression was significantly higher in immunocompetent vs. immunosuppressed patients, largely driven by very low expression in HIV+ patients. PMID: 29484464
  5. Colorectal cancer (CRC) patients expressing both high B7-H3 and high B3GALT4 contributed to a significant decrease in overall survival. The expression of B3GALT4 in CRC is positively correlated with B7-H3 expression in vitro. B7-H3/B3GLAT4 may be used as dual prognostic biomarkers for CRC. PMID: 30131660
  6. this study shows reduced sB7-H3 expression in the peripheral blood of systemic lupus erythematosus patients PMID: 29423417
  7. High B7-H3 expression is associated with cervical cancer invasiveness. PMID: 28627681
  8. IDH1 and B7H3 cannot be used as independent prognostic factors, co-expression of IDH1 and B7H3 significantly correlated with the prognosis of CRC patients and may serve as a combined predictive marker. Thus, the correlation between IDH1 and B7H3 has been proven in vivo and in vitro. PMID: 29871819
  9. Our findings revealed that B7-H3 affect ovarian cancer progression through the Jak2/Stat3 pathway, indicating that B7-H3 has the potential to be a useful prognostic marker. PMID: 28765941
  10. metastatic melanoma cells with knockdown expression of B7-H3 showed modest decrease in proliferation and glycolytic capacity. PMID: 28513992
  11. results suggest that B7-H3 may be a valuable biomarker in determining tumor progression and prognosis of intrahepatic cholangiocarcinoma PMID: 29696716
  12. these results demonstrate that sB7-H3 promotes invasion and metastasis through the TLR4/NF-kappaB pathway in pancreatic carcinoma PMID: 27273624
  13. Inhibition of the B7-H3 immune checkpoint limits tumor growth by enhancing cytotoxic lymphocyte function PMID: 28685773
  14. Higher B7-H3 expression correlates with Gleason grade, prostate cancer stage and poor oncologic outcomes in prostatectomy cohorts. B7-H3 expression appears to be related to androgen signaling as well as the immune reactome. PMID: 27801901
  15. Review/Meta-analysis: High B7-H3 expression was a significant indicator of lymph node metastasis and advanced TNM stage in non-small cell lung cancer. PMID: 27835582
  16. B7-H3 promotes epithelial mesenchymal transformation in colorectal cancer cells by activating the PI3K-Akt pathway and upregulating the expression of Smad1. PMID: 27145365
  17. Plasma B7-H3 levels were decreased significantly in children subjected to pediatric general and cardiac surgery, which is closely associated with the severity of surgical stress. The negative correlation of plasma B7-H3 levels at day 1 and day 3 after surgery with surgical stress scoring implicates that the plasma B7-H3 level might be a useful biomarker for monitoring stress intensity during pediatric surgery. PMID: 27459969
  18. B7-H3 promotes the oxaliplatin resistance in colorectal cancer cells upregulating the expression of XRCC1 via PI3K-AKT pathway. PMID: 28676400
  19. Children with Mycoplasma pneumoniae pneumonia had significantly higher levels of sB7-H3 and IL-36 compared to control subjects. PMID: 27188891
  20. CD276 is broadly expressed by tumor cells and tumor vasculature but Is dispensable for tumor growth. PMID: 28399408
  21. B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer PMID: 27939887
  22. We found that B7-H3 promoted the Warburg effect, evidenced by increased glucose uptake and lactate production in B7-H3-expressing cells. B7-H3 also increased the protein levels of HIF1alpha and its downstream targets, LDHA and PDK1, key enzymes in the glycolytic pathway PMID: 27197253
  23. Upregulated sB7-H3 expression in MPEs is correlated with TNM stage of NSCLC and may serve as a potential biomarker for NSCLC-derived MPEs PMID: 27071700
  24. High expression of B7-H3 is associated with Colorectal cancer. PMID: 26787540
  25. Elevated B7-H3 expression is significantly associated with poor survival in cancer patients. (Meta-analysis) PMID: 27626927
  26. The results provide novel insights into the function of B7-H3 in cancer, and suggest that targeting of B7-H3 may be a novel alternative to improve current anticancer therapies. PMID: 26771843
  27. Suggesting that B7-H3 and Tregs may act cooperatively in tumor immune evasion, leading to poor outcomes for NSCLC patients. PMID: 26823710
  28. B7-H3 is one of the most strongly expressed B7-family molecules in AML and merits further investigation. PMID: 26376842
  29. findings demonstrate that activation-induced B7-H3 expression on synovial monocytes has the potential to inhibit Th1-mediated immune responses and immunomodulatory roles affecting RA pathogenesis. PMID: 26702052
  30. B7H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer PMID: 26151358
  31. B7-H1 and B7-H3 are independent predictors of poorer survival in patients with non-small cell lung cancer. PMID: 25609202
  32. B7-H3 may play an important role in asthma exacerbation and was a useful clinical biomarker to evaluate asthma exacerbation. PMID: 26108069
  33. found that the N-glycans of B7-H3 from Ca9-22 oral cancer cells contain the terminal alpha-galactose and are more diverse with higher fucosylation and better interaction with DC-SIGN and Langerin on immune cells than that from normal cells PMID: 26438868
  34. Study shows that B7-H3 promotes mantle cell lymphoma progression and its knockdown significantly enhances the chemosensitivity. PMID: 25872657
  35. These results demonstrated that B7-H3 expression in acute leukemia predicts an unfavorable outcome. PMID: 25130683
  36. Our results indicate that B7-H3 expression in cervical invasive squamous cell carcinoma may play an important role in overcoming CD8(+) T-cell immunoregulation to acquire aggressive growth. PMID: 25675190
  37. Data shows that B7-H3 is aberrantly expressed in gastric cancer. In addition to modulating tumor immunity, B7-H3 may have a novel role in regulating SGC-7901 cell metastasis. PMID: 25120098
  38. Overexpression of B7-H3 in CD14+ monocytes is associated with renal cell carcinoma progression.B7-H3 might play an important role in angiogenesis of renal cell carcinoma mediated by CD14(+) monocytes. PMID: 25416051
  39. Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling. PMID: 26149216
  40. IL-2/IL-2R and B7-H3 pathways may be involved in the progression of clear cell renal cell carcinoma PMID: 25089268
  41. The overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer cell lines by upregulating the Jak2-STAT3 signaling pathway. PMID: 25684945
  42. B7-H3 was significantly up-regulated on monocytes in rheumatoid arthritis patients, while soluble B7-H3 in serum was decreased. A polymorphism variant, B7-H3-T-A-C-T, was shown to be associated with the incidence of RA and the decreased release of sB7-H3. PMID: 25931383
  43. B7-H3-mediated STAT3 signaling pathway is an important mechanism for inducing M2-type polarization of tumor associated macrophages. PMID: 25370943
  44. The study confirms the overexpression of B7-H3 in colorectal cancer and shows the main localization of the protein in cytoplasm and cell membrane. PMID: 25139714
  45. High level of serum B7-H3 in patients with Hepatocellular Carcinoma is caused by the increased expression of a newly discovered spliced soluble B7-H3 isoform in carcinoma and peritumor tissues. PMID: 24194851
  46. Data indicate that six sites of co-stimulatory molecule B7-H3 gene have single nucleotide polymorphisms variations and five sites are related to the pathogenesis of rheumatoid arthritis (RA). PMID: 25200161
  47. Study shows that CD276 can be used to discriminate ECs from malignant tissue from ECs from normal tissue. In addition, CD276(+) CEC do occur in higher frequencies in patients with advanced cancer. PMID: 24892449
  48. Data indicate that the expression of membrane B7-H3 (mB7-H3) in peri-tumor normal tissues was higher than that in tumor tissues, and it can serve as an assistant diagnostic marker for hepatitis B virus-associated hepatocellular carcinoma (HBV-HCC). PMID: 25001942
  49. B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, favoring an angiogenic phenotype. PMID: 24236063
  50. Thus, B7-H3 may have a critical role in primary hepatocellular carcinoma and it may enhance tumor escape from the immune surveillance of CD8(+) T cells. PMID: 24787022
  51. Soluble B7-H3 maybe plays an important role in immunopathogenesis of M. pneumoniae pneumonia, especially for increasing TNF-alpha concentration and activation neutrophils. PMID: 24139879
  52. High B7-H3 expression in human breast cancer tissues may be important in tumor progression and invasiveness. This expression appeared to be correlated with the ability of B7-H3 to promote IL-10 secretion PMID: 23128494
  53. B7-H3 is aberrantly expressed in CD133-positive colorectal cancer cells PMID: 24630518
  54. We identified miRNAs efficiently downregulating B7-H3 expression. The expression of miR-29c correlated with survival in breast cancer patients, suggesting a tumour suppressive role for this miRNA. PMID: 24577056
  55. PD-1 expression is upregulated in urothelial bladder carcinoma versus normal urothelium. PMID: 24140000
  56. B7-H3 expression in osteosarcoma cells is a potential mechanism controlling tumor immunity and invasive malignancy. PMID: 23940627
  57. miR-187 plays a tumor suppressor role in clear cell renal cell carcinoma in a pathway involving B7-H3 PMID: 23916610
  58. The study investigates the role of B7-H3 in pancreatic cancer progression and shows that this protein promotes cancer cell migration and invasiveness in vitro and in vivo. PMID: 23242015
  59. B7-H3 is a significant factor in melanoma progression and events of metastasis. PMID: 23474948
  60. The level of sB7-H3 in HCC patients was significantly higher than that in healthy people, and B7-H3 expression was correlated with clinical pathological indexes. PMID: 23746248
  61. Data suggest that the immunomodulatory proteins B7-H1, B7-H3, and HLA-G5 are secreted from early and term placenta via exosomes and have important implications in mechanisms by which trophoblast immunomodulators modify maternal immunological milieu. PMID: 23107341
  62. Membrane B7-H3 may be a promising biomarker that associates with the pathogenesis of multiple sclerosis. PMID: 22996270
  63. B7-H3 expression in tumor-associated vasculature and fibroblasts was observed in the majority of samples. PMID: 22473715
  64. The data suggested that B7-H3 was abundantly expressed in hepatocellular carcinoma and was associated with adverse clinicopathologic features and poor outcome. PMID: 22729558
  65. In myasthenia gravis (MG) patients, down-regulation of sB7-H3 is finely correlated to the severity of the disease. PMID: 22863596
  66. high expression level in prostate cancer correlates with the expression of the proliferation marker Ki-67, biochemical failure and clinical relapse PMID: 22487487
  67. The reduced expression of B7-H3 in the livers might temper the inhibition of T-cell responses mediated by B7-H3 expressed on hepatocytes and thus promote the hepatic inflammation and hepatitis progression in the chronic HBV-infected patients. PMID: 22187944
  68. our findings indicate a novel role for B7-H3 in the regulation of the metastatic capacity of melanoma cells PMID: 21671471
  69. regulates differentiation of bone marrow stromal cells to osteoblasts PMID: 21893365
  70. B7-H3 expression on cancer cells is correlated with the number of T cells infiltrating the tumor. Endometrium tumor development and progression may be associated with downregulation of T-cell-mediated antitumor immunity through B7-H3. PMID: 21982044
  71. Upregulation of B7-H3 is associated with induction of immunosuppressive phenotype of dendritic cells in Non-small cell lung cancer microenvironment. PMID: 21597388
  72. silencing of B7-H3 increased the sensitivity of multiple human breast cancer cell lines to paclitaxel as a result of enhanced drug-induced apoptosis. PMID: 21518725
  73. B7-H3 is aberrantly expressed in prostate cancer. In addition to modulating tumor immunity, B7-H3 may have a novel role in regulating PC-3 cell progression PMID: 21784485
  74. Analysis of B7-H3 protein expression indicates that comparable levels of B7-H3 are expressed on both primary human mesothelial and malignant mesothelial cell types. PMID: 21792917
  75. B7-H3 plays a crucial role in hypopharyngeal squamous cell carcinoma progression, tumor metastasis resulting in poor prognosis and might be involved in the negative regulation of T-cell-mediated tumor immune response. PMID: 21344157
  76. B7-H3 appears to be a useful blood marker for predicting tumor progression in gastric cancer PMID: 21251161
  77. role of B7-H3 in the regulation of T-cell response; its potential role in antitumor immunity (Review) PMID: 21127709
  78. B7-H3 protein expressed by primary breast cancer cells is associated with extent of regional nodal metastasis. PMID: 21107115
  79. B7-H3 functions as a costimulator of innate immunity by augmenting proinflammatory cytokine release from bacterial cell wall product-stimulated monocytes/macrophages and may contribute positively to the development of sepsis. PMID: 20696859
  80. higher expression in human colorectal carcinoma correlates with tumor progression PMID: 20333377
  81. Disease-free survival or overall survival of the gastric carcinoma patients with positive B7-H3 expression were significantly longer than those with negative B7-H3 expression. PMID: 17851789
  82. tumor-associated B7-H3 expression significantly correlates with prolonged postoperative survival;B7-H3 might play an important role as a potential stimulator of antitumor immune response in pancreatic cancer. PMID: 20035626
  83. results suggest circulating B7-H3 is a valuable biomarker for non-small cell lung cancer (NSCLC) and an elevated level of circulating B7-H3 suggests a poor clinical character for NSCLC. PMID: 19269710
  84. A novel structural variant of B7-H3 (named B7-H3b) with four Ig-like domains, is the major isoform expressed in several tissues and results from gene duplication and differential splicing. PMID: 12055244
  85. B7-H3 enhances T lymphocyte proliferation and IL-10 secretion when expressed in E. coli in vitro PMID: 15188059
  86. data suggest that 4Ig-B7-H3 molecules expressed at the neuroblastoma tumor cell surface can exert a protective role from natural killer-mediated lysis by interacting with a still undefined inhibitory receptor expressed on natural killer cells PMID: 15314238
  87. B7-H3 might be another valuable molecule marker for dendritic cells derived from monocytes PMID: 16274630
  88. Single nucleotide polymorphisms in the B7H3 gene are not associated with autoimmune myasthenia gravis. PMID: 17406098
  89. B7-H3 may be important for the interactions between fibroblast-like synoviocytes and T cells in rheumatoid arthritis and other diseases; the outcome of such interactions depends on the activation state of the T cell. PMID: 18292521
  90. B7-H3 is highly expressed in urothelial cell carcinoma across tumor stages, whereas B7-H1 and PD-1 expression are associated with advanced disease PMID: 18676751
  91. Overexpression of B7H3 is associated with tumor cell migration and invasion. PMID: 18690846
  92. Both tumor cell and tumor vasculature B7-H3 expression convey important information to predict clear cell renal cell carcinoma outcomes PMID: 18694993
  93. Progenitor cells from the anterior pituitary gland containing 4Ig-B7-H3 may play a critical role in the immunoendocrine network. PMID: 18941196

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophob
Database Links

HGNC: 19137

OMIM: 605715

KEGG: hsa:80381

STRING: 9606.ENSP00000320084

UniGene: Hs.744915

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1