Recombinant Human CD276 antigen (CD276), partial (Active)

In Stock
Code CSB-MP733578HU
Abbreviation Recombinant Human CD276 protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. Biological Activity Assay

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-245aa
Target Protein Sequence
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
Mol. Weight
53.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-Myc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD276 (B7-H3) is an immune checkpoint molecule increasingly implicated in tumor immune evasion, making it a high-priority target for therapeutic antibody development and checkpoint biology research. This recombinant human CD276 construct covers the extracellular region (aa 29–245) and is expressed in mammalian cells with a C-terminal hFc1-Myc tag, preserving native glycosylation and conformational integrity critical for antibody recognition. Functional ELISA validation demonstrates robust binding to an anti-CD276 rabbit monoclonal antibody with an EC50 of 1.961–2.243 ng/ml, confirming that this protein supports use in ligand-receptor interaction assays, blocking antibody screening, epitope mapping, and affinity characterization by SPR or BLI. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based checkpoint inhibition assays and small-molecule inhibitor screening campaigns in immuno-oncology drug discovery.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Antigen, ELISA standard and its raw materials

Review: I used the CSB-MP733578HU protein for an ELISA experiment, and the EC50 was measured to be 0.3038-0.6364 ng/ml. This antigen has been validated by ELISA experiment and has good activity, making it suitable for later detection of animal immune serum titers and screening of hybridoma-positive clones.

By Anonymous

 Q&A
Q:

Are CUSABIO recombinant proteins sterile?

A:

Yes, we can offer an aseptic processing service and it is free of charge, but you should remark this information when placing the order. We've performed aseptic processing for liquid protein before lyophilization, but there may exist contamination during lyophilization process. To clarify, lyophilized proteins can’t guarantee aseptic processing for the whole manufacture process.

Q:

Can you remove the endotoxin?

A:

Not all endotoxin can be removed. Please contact us in advance if you need to remove the tag which takes 2-3 business days. We could offer endotoxin removal service free of charge using PMB affinity chromatography, use LAL reagent to semi-quantitatively detect the content of endotoxin, and guarantee endotoxin level within 0.1 ng/μg (1 EU/μg).

Q:

How to avoid inclusion bodies and improve soluble expression?

A:

a. For proteins with high hydrophobicity or transmembrane domains, you should add fusion tags or add heat shock chaperones, and induce for a shorter time at low temperature or change to poor media. Generate truncated forms of protein or use membrane-rich strains.
b. For incorrect disulfide bond formation, you should add fusion partners, including thioredoxin, DsbA, DsbC. Clone in a vector containing secretion signal peptide to cell periplasm. Use gamiB (DE3)strains with the oxidative cytoplasmic environment. Lower inducer concentration and induction temperature.
c. For incorrect folding, you should use a fusion partner. Co-express with molecular chaperones. Use strains with cold-adapted chaperones. Supplement media with chemical chaperones and cofactors. Reduce the inducer concentration and add fresh media. Induce for a shorter time at low temperature.

Target Background

Function

Earlier studies found that B7H3 (also known as B7H3) promotes the activation of T cells. Chapoval et al. confirmed that in the presence of anti-CD3 antibodies, B7H3 can promote the proliferation of CD4 and CD8+ T cells and selectively promote the secretion of IFN-γ. And B7H3 transfection into tumor cells can enhance the killing ability of CTL. Further research found that only TLT-2 transgenic cells could bind to mouse B7H3 with high affinity, and TLT-2 was determined to be the receptor molecule of B7H3. Moreover, Hashiguchi et al. confirmed that the B7H3-TLT-2 pathway enhanced T cell activation. However, Leitner et al. did not find the specific binding of B7H3 to TLT-2 by flow cytometry, therefore, the exact receptor molecule of B7H3 is still unclear.
On the other hand, studies have found that B7H3 can also suppress T-cell immune responses. Some studies have shown that B7H3 can inhibit human and mouse T cells by activating or inhibiting NFTA (nuclear factor for activated T cells), NF-KB (nuclear factor kB) and AP-1 (activator protein-1) pathways. activation. In addition, results have demonstrated that B7H3 may inhibit T cell immune responses by inhibiting the activity of Thl. The study of Leiner et al. also found that B7H3 can down-regulate the secretion of IL-2 in T cells to inhibit the activity of T cells.

Gene References into Functions
  1. High B7-H3 expression is associated with phyllodes tumors. PMID: 30486739
  2. characterization of the expression pattern and biological function of B7-H3 in brain gliomas; B7-H3 expression is regulated by multiple mechanisms and is potentially involved in the T-cell receptor signaling pathway; higher B7-H3 expression indicates a worse prognosis for glioma patients PMID: 30027617
  3. High expression level of B7H3 in muscleinvasive bladder cancer (MIBC) tissues is associated with a poor clinico-pathological status and poor prognosis, and promotes the development of MIBC in vitro and in vivo. PMID: 30132557
  4. Tumor B7-H3 expression was significantly higher in immunocompetent vs. immunosuppressed patients, largely driven by very low expression in HIV+ patients. PMID: 29484464
  5. Colorectal cancer (CRC) patients expressing both high B7-H3 and high B3GALT4 contributed to a significant decrease in overall survival. The expression of B3GALT4 in CRC is positively correlated with B7-H3 expression in vitro. B7-H3/B3GLAT4 may be used as dual prognostic biomarkers for CRC. PMID: 30131660
  6. this study shows reduced sB7-H3 expression in the peripheral blood of systemic lupus erythematosus patients PMID: 29423417
  7. High B7-H3 expression is associated with cervical cancer invasiveness. PMID: 28627681
  8. IDH1 and B7H3 cannot be used as independent prognostic factors, co-expression of IDH1 and B7H3 significantly correlated with the prognosis of CRC patients and may serve as a combined predictive marker. Thus, the correlation between IDH1 and B7H3 has been proven in vivo and in vitro. PMID: 29871819
  9. Our findings revealed that B7-H3 affect ovarian cancer progression through the Jak2/Stat3 pathway, indicating that B7-H3 has the potential to be a useful prognostic marker. PMID: 28765941
  10. metastatic melanoma cells with knockdown expression of B7-H3 showed modest decrease in proliferation and glycolytic capacity. PMID: 28513992
  11. results suggest that B7-H3 may be a valuable biomarker in determining tumor progression and prognosis of intrahepatic cholangiocarcinoma PMID: 29696716
  12. these results demonstrate that sB7-H3 promotes invasion and metastasis through the TLR4/NF-kappaB pathway in pancreatic carcinoma PMID: 27273624
  13. Inhibition of the B7-H3 immune checkpoint limits tumor growth by enhancing cytotoxic lymphocyte function PMID: 28685773
  14. Higher B7-H3 expression correlates with Gleason grade, prostate cancer stage and poor oncologic outcomes in prostatectomy cohorts. B7-H3 expression appears to be related to androgen signaling as well as the immune reactome. PMID: 27801901
  15. Review/Meta-analysis: High B7-H3 expression was a significant indicator of lymph node metastasis and advanced TNM stage in non-small cell lung cancer. PMID: 27835582
  16. B7-H3 promotes epithelial mesenchymal transformation in colorectal cancer cells by activating the PI3K-Akt pathway and upregulating the expression of Smad1. PMID: 27145365
  17. Plasma B7-H3 levels were decreased significantly in children subjected to pediatric general and cardiac surgery, which is closely associated with the severity of surgical stress. The negative correlation of plasma B7-H3 levels at day 1 and day 3 after surgery with surgical stress scoring implicates that the plasma B7-H3 level might be a useful biomarker for monitoring stress intensity during pediatric surgery. PMID: 27459969
  18. B7-H3 promotes the oxaliplatin resistance in colorectal cancer cells upregulating the expression of XRCC1 via PI3K-AKT pathway. PMID: 28676400
  19. Children with Mycoplasma pneumoniae pneumonia had significantly higher levels of sB7-H3 and IL-36 compared to control subjects. PMID: 27188891
  20. CD276 is broadly expressed by tumor cells and tumor vasculature but Is dispensable for tumor growth. PMID: 28399408
  21. B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer PMID: 27939887
  22. We found that B7-H3 promoted the Warburg effect, evidenced by increased glucose uptake and lactate production in B7-H3-expressing cells. B7-H3 also increased the protein levels of HIF1alpha and its downstream targets, LDHA and PDK1, key enzymes in the glycolytic pathway PMID: 27197253
  23. Upregulated sB7-H3 expression in MPEs is correlated with TNM stage of NSCLC and may serve as a potential biomarker for NSCLC-derived MPEs PMID: 27071700
  24. High expression of B7-H3 is associated with Colorectal cancer. PMID: 26787540
  25. Elevated B7-H3 expression is significantly associated with poor survival in cancer patients. (Meta-analysis) PMID: 27626927
  26. The results provide novel insights into the function of B7-H3 in cancer, and suggest that targeting of B7-H3 may be a novel alternative to improve current anticancer therapies. PMID: 26771843
  27. Suggesting that B7-H3 and Tregs may act cooperatively in tumor immune evasion, leading to poor outcomes for NSCLC patients. PMID: 26823710
  28. B7-H3 is one of the most strongly expressed B7-family molecules in AML and merits further investigation. PMID: 26376842
  29. findings demonstrate that activation-induced B7-H3 expression on synovial monocytes has the potential to inhibit Th1-mediated immune responses and immunomodulatory roles affecting RA pathogenesis. PMID: 26702052
  30. B7H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer PMID: 26151358
  31. B7-H1 and B7-H3 are independent predictors of poorer survival in patients with non-small cell lung cancer. PMID: 25609202
  32. B7-H3 may play an important role in asthma exacerbation and was a useful clinical biomarker to evaluate asthma exacerbation. PMID: 26108069
  33. found that the N-glycans of B7-H3 from Ca9-22 oral cancer cells contain the terminal alpha-galactose and are more diverse with higher fucosylation and better interaction with DC-SIGN and Langerin on immune cells than that from normal cells PMID: 26438868
  34. Study shows that B7-H3 promotes mantle cell lymphoma progression and its knockdown significantly enhances the chemosensitivity. PMID: 25872657
  35. These results demonstrated that B7-H3 expression in acute leukemia predicts an unfavorable outcome. PMID: 25130683
  36. Our results indicate that B7-H3 expression in cervical invasive squamous cell carcinoma may play an important role in overcoming CD8(+) T-cell immunoregulation to acquire aggressive growth. PMID: 25675190
  37. Data shows that B7-H3 is aberrantly expressed in gastric cancer. In addition to modulating tumor immunity, B7-H3 may have a novel role in regulating SGC-7901 cell metastasis. PMID: 25120098
  38. Overexpression of B7-H3 in CD14+ monocytes is associated with renal cell carcinoma progression.B7-H3 might play an important role in angiogenesis of renal cell carcinoma mediated by CD14(+) monocytes. PMID: 25416051
  39. Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling. PMID: 26149216
  40. IL-2/IL-2R and B7-H3 pathways may be involved in the progression of clear cell renal cell carcinoma PMID: 25089268
  41. The overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer cell lines by upregulating the Jak2-STAT3 signaling pathway. PMID: 25684945
  42. B7-H3 was significantly up-regulated on monocytes in rheumatoid arthritis patients, while soluble B7-H3 in serum was decreased. A polymorphism variant, B7-H3-T-A-C-T, was shown to be associated with the incidence of RA and the decreased release of sB7-H3. PMID: 25931383
  43. B7-H3-mediated STAT3 signaling pathway is an important mechanism for inducing M2-type polarization of tumor associated macrophages. PMID: 25370943
  44. The study confirms the overexpression of B7-H3 in colorectal cancer and shows the main localization of the protein in cytoplasm and cell membrane. PMID: 25139714
  45. High level of serum B7-H3 in patients with Hepatocellular Carcinoma is caused by the increased expression of a newly discovered spliced soluble B7-H3 isoform in carcinoma and peritumor tissues. PMID: 24194851
  46. Data indicate that six sites of co-stimulatory molecule B7-H3 gene have single nucleotide polymorphisms variations and five sites are related to the pathogenesis of rheumatoid arthritis (RA). PMID: 25200161
  47. Study shows that CD276 can be used to discriminate ECs from malignant tissue from ECs from normal tissue. In addition, CD276(+) CEC do occur in higher frequencies in patients with advanced cancer. PMID: 24892449
  48. Data indicate that the expression of membrane B7-H3 (mB7-H3) in peri-tumor normal tissues was higher than that in tumor tissues, and it can serve as an assistant diagnostic marker for hepatitis B virus-associated hepatocellular carcinoma (HBV-HCC). PMID: 25001942
  49. B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, favoring an angiogenic phenotype. PMID: 24236063
  50. Thus, B7-H3 may have a critical role in primary hepatocellular carcinoma and it may enhance tumor escape from the immune surveillance of CD8(+) T cells. PMID: 24787022

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophob
Database Links

HGNC: 19137

OMIM: 605715

KEGG: hsa:80381

STRING: 9606.ENSP00000320084

UniGene: Hs.744915

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*