Code | CSB-MP733578HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The DNA fragment corresponding to Leu29-Gly245 of the human CD276 antigen is fused with an FC-Myc-tag at the C-terminus and then is expressed in the mammalian cells. The resulting product is the recombinant human CD276 antigen. Its purity is over 93% measured by SDS-PAGE. On the gel, this protein was migrated to the molecular weight band of about 60-80 kDa. The endotoxin content of this CD276 protein is less than 1.0 EU/ug determined by the LAL method. Its bioactivity has been validated through an ELISA. In the functional ELISA, this recombinant CD276 protein can bind to the anti-CD276 antibody, and the EC50 is 1.961-2.243 ng/ml. This CD276 protein is available now. CD276 is an immune checkpoint molecule in the epithelial-mesenchymal transition (EMT) pathway. It is involved in cell proliferation, invasion, and metastasis in malignancies. Overexpression of CD276 has been found in numerous solid tumors such as breast, colorectal, and lung cancer, and has been strongly linked to a poor clinical prognosis. |
Purity | Greater than 93% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. |
Target Names | CD276 |
Uniprot No. | Q5ZPR3 |
Research Area | Cancer |
Alternative Names | 4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 29-245aa |
Target Protein Sequence | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG |
Mol. Weight | 53.4 kDa |
Protein Length | Partial |
Tag Info |
C-terminal FC-Myc-tagged |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Are CUSABIO recombinant proteins sterile?
Yes, we can offer an aseptic processing service and it is free of charge, but you should remark this information when placing the order. We've performed aseptic processing for liquid protein before lyophilization, but there may exist contamination during lyophilization process. To clarify, lyophilized proteins can’t guarantee aseptic processing for the whole manufacture process.
Can you remove the endotoxin?
Not all endotoxin can be removed. Please contact us in advance if you need to remove the tag which takes 2-3 business days. We could offer endotoxin removal service free of charge using PMB affinity chromatography, use LAL reagent to semi-quantitatively detect the content of endotoxin, and guarantee endotoxin level within 0.1 ng/μg (1 EU/μg).
How to avoid inclusion bodies and improve soluble expression?
a. For proteins with high hydrophobicity or transmembrane domains, you should add fusion tags or add heat shock chaperones, and induce for a shorter time at low temperature or change to poor media. Generate truncated forms of protein or use membrane-rich strains.
b. For incorrect disulfide bond formation, you should add fusion partners, including thioredoxin, DsbA, DsbC. Clone in a vector containing secretion signal peptide to cell periplasm. Use gamiB (DE3)strains with the oxidative cytoplasmic environment. Lower inducer concentration and induction temperature.
c. For incorrect folding, you should use a fusion partner. Co-express with molecular chaperones. Use strains with cold-adapted chaperones. Supplement media with chemical chaperones and cofactors. Reduce the inducer concentration and add fresh media. Induce for a shorter time at low temperature.
Function |
Earlier studies found that B7H3 (also known as B7H3) promotes the activation of T cells. Chapoval et al. confirmed that in the presence of anti-CD3 antibodies, B7H3 can promote the proliferation of CD4 and CD8+ T cells and selectively promote the secretion of IFN-γ. And B7H3 transfection into tumor cells can enhance the killing ability of CTL. Further research found that only TLT-2 transgenic cells could bind to mouse B7H3 with high affinity, and TLT-2 was determined to be the receptor molecule of B7H3. Moreover, Hashiguchi et al. confirmed that the B7H3-TLT-2 pathway enhanced T cell activation. However, Leitner et al. did not find the specific binding of B7H3 to TLT-2 by flow cytometry, therefore, the exact receptor molecule of B7H3 is still unclear. |
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Tissue Specificity | Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophob |
Database Links |
HGNC: 19137 OMIM: 605715 KEGG: hsa:80381 STRING: 9606.ENSP00000320084 UniGene: Hs.744915 |