Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP865099HU |
| Size | $428 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
This Human CD93 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human CD93 (22-580aa) was expressed with the C-terminal 10xHis tag. The purity of this CD93 protein was greater than 90% by SDS-PAGE. The activity was validated. The function of CD93 is thought to be involved in intercellular adhesion and clearance of apoptotic cells and is associated with various inflammatory and immune-related diseases, including asthma. CD93 is a transmembrane receptor that is upregulated in tumor blood vessels in many cancers. Studies have demonstrated that CD93 regulates β1 integrin signaling activation and fibronectin fibrillation during tumor angiogenesis. A recent study comparing gene expression profiling of tumors under VEGF inhibitor treatment in vivo identified CD93 as a candidate receptor downregulated in VEGF inhibition and a potential target for mediating vascular normalization. This study also confirmed the pro-angiogenic effect of CD93 in endothelial cells. Tumor angiogenesis is an important condition for tumor development, invasion and metastasis, and inhibition of angiogenesis can be used as a therapeutic strategy for tumor therapy. In recent years, targeting pro-angiogenic genes has become a research hotspot for tumor therapy and prevention of tumor expansion. CD93 has a key role in tumor vascular maturation and is a potential therapeutic target.
|
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7 (CSB-MP620956HUd9), the EC50 is 20.34-26.92 ng/mL.Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Anti-CD93 recombinant antibody (CSB-RA865099MA1HU), the EC50 is 0.6639-1.173 ng/mL. |
| Target Names | CD93 |
| Uniprot No. | Q9NPY3 |
| Alternative Names | (C1q/MBL/SPA receptor)(CDw93)(Complement component 1 q subcomponent receptor 1)(Matrix-remodeling-associated protein 4)(CD_antigen: CD93)(C1qR)(C1qR(p))(C1qRp) |
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 22-580aa |
| Target Protein Sequence | TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK |
| Mol. Weight | 60.1 kDa |
| Protein Length | Partial |
| Tag Info |
C-terminal 10xHis-tagged |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Receptor (or element of a larger receptor complex) for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). May mediate the enhancement of phagocytosis in monocytes and macrophages upon interaction with soluble defense collagens. May play a role in intercellular adhesion.
|
| Gene References into Functions |
|
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Tissue Specificity | Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin. |
| Database Links |
HGNC: 15855 OMIM: 120577 KEGG: hsa:22918 STRING: 9606.ENSP00000246006 UniGene: Hs.97199 |
