Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.
Alternative Names
Class-I MHC-restricted T-cell-associated molecule;CD355
Species
Homo sapiens (Human)
Expression Region
18-287aa
Target Protein Sequence
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene fragment encoding amino acids 18 to 287 of the human CRTAM protein was fused with a 10xHis-tag gene at the C-terminus. This combined fragment was then inserted into a plasmid vector. Following this, the modified vector was introduced into mammalian cells. The transfected mammalian cells were subsequently selected and cultured to induce the expression of the protein. The production is the recombinant human CRTAM protein. Its purity was determined to be over 95% through SDS-PAGE analysis, and the level of endotoxin present was less than 1.0 EU/μg using the LAL method. The protein's functional capacity was verified using a functional ELISA test. When immobilized at a concentration of 2 μg/mL, the human CRTAM protein exhibited the ability to bind with human CADM1 (CSB-MP004425HUd9), demonstrating an EC50 within the range of 2.277 to 2.649 ng/mL.
CRTAM, also known as CD355, is a type I restricted T cell-associated molecule, belonging to the IgSF superfamily and closely associated with lectin-like proteins. CRTAM is an emerging immune cell NK receptor and plays a critical role in the retention of CD8+ T cells and the differentiation of lymph node-resident CTL effector cells. CRTAM interacts with the ligand CADM1/Necl-2 expressed on dendritic cells, promoting the cytotoxicity of natural killer (NK) cells as well as the rejection response of CADM1-expressing tumors mediated by NK cells in vivo. The interaction between CRTAM and Necl-2 triggers cell death in activated TVg9Vd2 γδ T cells, which is conducive to immune evasion.