Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.

Target Names

CRTAM

Uniprot No.

O95727

Alternative Names

Class-I MHC-restricted T-cell-associated molecule;CD355

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

18-287aa

Target Protein Sequence

SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG

Mol. Weight

31.4KDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CRTAM mediates adhesion and cytotoxic effector functions in NK and CD8+ T cells through its interaction with CADM1, making quantitative characterization of this receptor-ligand pair essential for understanding immune synapse formation and T-cell activation. This mammalian-expressed construct spanning residues 18–287 demonstrates robust binding to human CADM1 with an EC50 of 2.277–2.649 ng/mL in functional ELISA, providing a validated reagent for ligand-binding assays, competitive inhibition studies, and therapeutic antibody epitope mapping targeting the CRTAM–CADM1 axis. The low picomolar EC50 supports use in surface plasmon resonance and biolayer interferometry experiments requiring sensitive affinity characterization, as well as in screening campaigns for biologics or small molecules that modulate this costimulatory pathway. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in functional binding assays and antibody validation workflows where contaminant interference must be minimized.

Target Background

Function

Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo. Regulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation. Appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Interaction with SCRIB promotes the late phase of cellular polarization of a subset of CD4+ T-cells, which in turn regulates TCR-mediated proliferation and IFNG, IL17 and IL22 production. By interacting with CADM1 on CD8+ dendritic cells, regulates the retention of activated CD8+ T-cells within the draining lymph node. Required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells. Interaction with CADM1 promotes the adhesion to gut-associated CD103+ dendritic cells, which may facilitate the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells.

Gene References into Functions

These results reveal that CRTAM is critical to instruct the differentiation of CD4(+)CTL through the induction of Eomes and CTL-related gene. PMID: 26694968
CRTAM is negatively regulated by ZEB1 in T cells. PMID: 25910959
Case-control studies reveal malignant mesothelioma risk associated with variants in the SDK1, CRTAM and RASGRF2 genes. PMID: 23827383
The cell adhesion molecule Necl-2 competitively binds the immune receptor CRTAM. PMID: 23871486
The expression of CRTAM in activated Vgamma9Vdelta2 T cells is quickly downregulated following interaction with Necl-2 on tumor cells. PMID: 23530148
Three common variants in the class I MHC-restricted T cell-associated molecule gene were identified that were associated with an increased rate of asthma exacerbations based on the presence of a low circulating vitamin D level. PMID: 22051697
Results show that CRTAM is a molecule involved in epithelial cell adhesion. PMID: 20556794
Necl2/CRTAM molecular pair could regulate a large panel of cell/cell interactions both within and outside of the immune system PMID: 15781451
NK cells and T8 cells recognize Necl-2 through CRTAM, expressed only on activated cells. CRTAM-Necl-2 interactions promote cytotoxicity of NK cells and IFN-gamma secretion of T8 cells as well as NK cell-mediated rejection of tumors expressing Necl-2 PMID: 15811952
CRTAM expression is driven by the JNK-AP-1 signaling pathway. PMID: 19695707

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Nectin family

Tissue Specificity

In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 T-cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at

Database Links

HGNC: 24313

OMIM: 612597

KEGG: hsa:56253

STRING: 9606.ENSP00000227348

UniGene: Hs.159523

Code	CSB-MP005998HU1d7
Abbreviation	Recombinant Human CRTAM protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2μg/mL can bind Human CADM1(CSB-MP004425HUd9)，the EC₅₀ is 2.277-2.649 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage