Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to bind Human CADM1 in functional ELISA is less than 20 ug/ml.

Target Names

CRTAM

Uniprot No.

O95727

Research Area

Immunology

Alternative Names

CRTAM; Cytotoxic and regulatory T-cell molecule; Class-I MHC-restricted T-cell-associated molecule; CD antigen CD355

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

18-286aa

Complete Sequence

SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

Mol. Weight

30.99 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo. Regulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation. Appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Interaction with SCRIB promotes the late phase of cellular polarization of a subset of CD4+ T-cells, which in turn regulates TCR-mediated proliferation and IFNG, IL17 and IL22 production. By interacting with CADM1 on CD8+ dendritic cells, regulates the retention of activated CD8+ T-cells within the draining lymph node. Required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells. Interaction with CADM1 promotes the adhesion to gut-associated CD103+ dendritic cells, which may facilitate the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells.

Gene References into Functions

These results reveal that CRTAM is critical to instruct the differentiation of CD4(+)CTL through the induction of Eomes and CTL-related gene. PMID: 26694968
CRTAM is negatively regulated by ZEB1 in T cells. PMID: 25910959
Case-control studies reveal malignant mesothelioma risk associated with variants in the SDK1, CRTAM and RASGRF2 genes. PMID: 23827383
The cell adhesion molecule Necl-2 competitively binds the immune receptor CRTAM. PMID: 23871486
The expression of CRTAM in activated Vgamma9Vdelta2 T cells is quickly downregulated following interaction with Necl-2 on tumor cells. PMID: 23530148
Three common variants in the class I MHC-restricted T cell-associated molecule gene were identified that were associated with an increased rate of asthma exacerbations based on the presence of a low circulating vitamin D level. PMID: 22051697
Results show that CRTAM is a molecule involved in epithelial cell adhesion. PMID: 20556794
Necl2/CRTAM molecular pair could regulate a large panel of cell/cell interactions both within and outside of the immune system PMID: 15781451
NK cells and T8 cells recognize Necl-2 through CRTAM, expressed only on activated cells. CRTAM-Necl-2 interactions promote cytotoxicity of NK cells and IFN-gamma secretion of T8 cells as well as NK cell-mediated rejection of tumors expressing Necl-2 PMID: 15811952
CRTAM expression is driven by the JNK-AP-1 signaling pathway. PMID: 19695707

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Nectin family

Tissue Specificity

In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 T-cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at

Database Links

HGNC: 24313

OMIM: 612597

KEGG: hsa:56253

STRING: 9606.ENSP00000227348

UniGene: Hs.159523

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-AP005441HU
MSDS	MSDS
Size	$154
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage