Recombinant Human Ephrin-A5(EFNA5) (Active)

^{In Stock}

Code	CSB-MP007464HU

Size	US$298
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC₅₀ of human EFNA5 protein is 0.8674-1.119 ng/ml. Biological Activity Assay Activity Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 pM as detected by LSPR Assay. Biological Activity Assay

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 93% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	①Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. ②Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 pM as detected by LSPR Assay.
Target Names	EFNA5
Uniprot No.	P52803
Research Area	Cancer
Alternative Names	AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	21-203aa
Target Protein Sequence	QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Mol. Weight	50.1 kDa
Protein Length	Full Length of Mature Protein
Tag Info	C-terminal FC-tagged
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Target Data

Function	Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Membrane, caveola, Lipid-anchor, GPI-anchor
Protein Families	Ephrin family
Database Links	HGNC: 3225 OMIM: 601535 KEGG: hsa:1946 STRING: 9606.ENSP00000328777 UniGene: Hs.288741