Home
Active Protein
Other
Recombinant Human Ephrin-A5 (EFNA5) (Active)

Recombinant Human Ephrin-A5 (EFNA5) (Active)

Name: Recombinant Human Ephrin-A5 (EFNA5) (Active)
Brand: CUSABIO
SKU: CSB-MP007464HU
Price: $116 USD
Availability: InStock
Rating: 5.0 (1 reviews)

^{In Stock} ^Promotion

Code	CSB-MP007464HU
Abbreviation	Recombinant Human EFNA5 protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC₅₀ of human EFNA5 protein is 0.8674-1.119 ng/ml. Biological Activity Assay Activity Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. ②Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay.

Target Names

EFNA5

Uniprot No.

P52803

Research Area

Cancer

Alternative Names

EPLG7; AF1; AL 1; AL-1; EFL5; Efna5; EFNA5_HUMAN; EPH-related receptor tyrosine kinase ligand 7; Ephrin A5; Ephrin-A5; EPLG7; GLC1M; LERK-7; LERK7; RAGS

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

21-203aa

Target Protein Sequence

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Mol. Weight

50.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Ephrin-A5 plays a critical role in EphA receptor-mediated axon guidance, tissue boundary formation, and tumor angiogenesis, making it a key target in cancer biology research. This recombinant human EFNA5 covers the full mature protein (aa 21–203) with a C-terminal hFc1 tag and demonstrates exceptional receptor-binding potency, with an EC50 of 0.87–1.12 ng/ml against immobilized EphA3 in functional ELISA, supporting direct use in receptor-ligand binding assays, competition ELISAs, and SPR-based interaction studies. Expression in mammalian cells preserves native glycosylation patterns essential for proper receptor engagement, which provides a suitable basis for cell-based proliferation assays, neuronal differentiation studies, and in vivo tumor biology models. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell culture experiments and antibody characterization workflows.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Antigen, Binding assay/Protein-protein interaction

Review: I conducted an ELISA experiment using the CSB-MP007464HU product, and the EC50 was measured to be 0.9734-1.179 ng/ml. This protein has good binding activity, stable protein properties, good repeatability, and smooth progress in subsequent experiments! I plan to purchase large quantities in the future.

By Anonymous

Target Background

Function

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.

Gene References into Functions

These results indicate a novel mechanism of ephrin-Eph signaling independent of direct cell contact and proteolytic cleavage and suggest the participation of EphB2(+) extracellular vesicles in neural development and synapse physiology. PMID: 27354374
MiR-96 and miR-182 are upregulated in hepatocellular carcinoma and negatively associated with ephrin A5 expression. PMID: 25663355
the structure of the ligand-binding domain of the EphA3 receptor in complex with its preferred ligand, ephrin-A5, is reported. PMID: 25993310
The genetic variations c.668C>T (rs201008479), c.102C>T (rs199980747) and c.-27C>G (rs200187971) may present an additional genetic risk factor for age-related cataract in the Chinese population. PMID: 25300504
Data indicate that ephrin-A5 binding directly facilitates the formation of Eph/ephrin clusters by inducing conformational changes in the ligand-binding domain (LBD) of EphA4. PMID: 23959867
Transgenic ephrin-A5 plays a critical role in postnatal lens fiber organization to maintain lens transparency: cells in the ephrin-A5-deficient lens are severely disorganized PMID: 23401654
EphrinA5, especially ephrinA5S, acts as a tumor suppressor in hepatocarcinogenesis. PMID: 22860012
This study presented that EFNA5 showed strong associations with alcohol withdrawal symptoms. PMID: 22072270
Data suggest that ephrinA5 mRNA/protein levels are reduced in colon adenocarcinoma compared to normal colon tissue; staging/grading indicates that ephrinA5 inhibits colon adenocarcinoma progression via c-Cbl-mediated EGFR ubiquitination/degradation. PMID: 22074469
ephrin-A5-induced cell-morphologic changes of EphA3-positive LK63 pre-B acute lymphoblastic leukemia cells PMID: 18385452
These observations indicate that only a subset of signal transduction pathways is required for ephrin-A5-induced growth cone collapse. PMID: 18563700
ephrinA5 acted as a tumor suppressor in glioma, and its negative regulation of EGFR contributed to the suppressive effects. PMID: 19270726
EFNA5 down-regulation is a consistent finding in chondrosarcomas PMID: 19695673

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Membrane, caveola; Lipid-anchor, GPI-anchor. Note=Compartmentalized in discrete caveolae-like membrane microdomains.

Protein Families

Ephrin family

Database Links

HGNC: 3225

OMIM: 601535

KEGG: hsa:1946

STRING: 9606.ENSP00000328777

UniGene: Hs.288741

Promotions