Code | CSB-MP007464HU |
Size |
US$298Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Recombinant Human Ephrin-A5 (EFNA5) is expressed at the full length of the mature protein in mammalian cells, which corresponds to the 21-203aa region of human EFNA5. The protein has a TEV-linker and an immunoglobulin Fc domain fused on the C-terminus, with a molecular weight of 50.1 kDa. This protein product has a purity higher than 93%, as determined by SDS-PAGE. In the LSPR assay, it has an affinity constant of 13.8 nM against human EPHA3 protein. Also, the recombinant EFNA5 has an EC50 of 0.8674-1.119 ng/ml for binding to EPHA3, as determined by ELISA binding assay. The final product contains low endotoxin, with less than 1.0 EU/µg as determined by the LAL method. The EFNA5 is a promiscuous cell surface GPI-bound ligand that permits the cellular adhesion and contact-dependent directional signaling. The function of EFNA5 is vital for the nervous system development via axion fasciculation and the reorganization of the cytoskeleton. This product can be used in cancer research as cell adhesion reagent, ELISA reagent, and control for novel ligands for the associated ephrin receptor. |
Purity | Greater than 93% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | ①Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. ②Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay. |
Target Names | EFNA5 |
Uniprot No. | P52803 |
Research Area | Cancer |
Alternative Names | EPLG7; AF1; AL 1; AL-1; EFL5; Efna5; EFNA5_HUMAN; EPH-related receptor tyrosine kinase ligand 7; Ephrin A5; Ephrin-A5; EPLG7; GLC1M; LERK-7; LERK7; RAGS |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 21-203aa |
Target Protein Sequence | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
Mol. Weight | 50.1 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal hFc-tagged |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Membrane, caveola; Lipid-anchor, GPI-anchor. Note=Compartmentalized in discrete caveolae-like membrane microdomains. |
Protein Families | Ephrin family |
Database Links |
HGNC: 3225 OMIM: 601535 KEGG: hsa:1946 STRING: 9606.ENSP00000328777 UniGene: Hs.288741 |