Name: Recombinant Human Retinol-binding protein 4(RBP4) (Active)
Brand: CUSABIO
SKU: CSB-MP019483HU

Product Details

Description	Human retinol-binding protein 4 (RBP4) amino acid Glu19-Leu201 linked a C-terminal human IgG1 Fc tag by the TEV linker, as well as an N-terminal linker, was expressed in mammalian cells. The product is the C-terminally hFc-tagged recombinant human RBP4 protein. This recombinant RBP4 protein is an active protein, whose bioactivity has been measured by its binding with the TTR in a functional ELISA, with the EC₅₀ of 695.0-970.1 ng/ml. The purity of this protein is greater than 92% determined by SDS-PAGE. It has an apparent molecular weight of 55 kDa on the gel while its predicted mass is 50 kDa. It contains less endotoxin (<1.0 EU/ug protein), measured by the LAL method. Its protein length covers the full length of the mature RBP4 protein. It is in stock now. RBP4, mainly synthesized in the liver and adipose tissue, facilitates the transport of retinol from the liver to the peripheral organs. It is also an adipokine and fatty acid transporter. Besides, RBP4 is one of the adipokines involved in the development of insulin resistance.
Purity	Greater than 92% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	①Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC₅₀ is 695.0-970.1 ng/ml.
Target Names	RBP4
Uniprot No.	P02753
Research Area	Cancer
Alternative Names	(Plasma retinol-binding protein)(PRBP)(RBP)
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	19-201aa
Target Protein Sequence	ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Mol. Weight	50.0 kDa
Protein Length	Full Length of Mature Protein
Tag Info	C-terminal hFc-tagged
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Related Products

Target Background

Function	Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Gene References into Functions	Baseline RBP4 levels and MELD scores predicted 21-day (/=25) mortality, respectively. In critically ill patients with underlying liver disease, with a link to eGFRs, INRs and TC levels, the baseline RBP4 may serve as a marker for short-term mortality. PMID: 28588245 our study provides clinical evidence revealing that the serum concentrations of RBP4 were elevated in NAFLD patients in a Chinese population. These findings indicated that RBP4 might be a noninvasive molecular biomarker that detects the presence of NAFLD in middle-aged and elderly population. PMID: 28332619 Vitreous levels of APOA1 and RBP4 in human rhegmatogenous retinal detachment associated with choroidal detachment reflects the severity of disease. PMID: 29618920 The overexpression of RBP4 increased cell proliferation, whereas siRNA-mediated RBP4 knockdown significantly decreased HTR8/SVneo cell proliferation via activation of PI3K/AKT signaling. PMID: 30015949 High RBP4 expression is associated with hypertriglyceridemia. PMID: 29747616 We observed that knockdown of RBP4 can greatly suppress ovarian cancer cell migration and proliferation. PMID: 29642915 This study showed that the Levels of circulating RBP4 was significantly higher in Chronic Kidney Disease than in control. PMID: 29678848 Our results demonstrate that IR is associated with high circulating RBP4 and that suppressed RBP4 adipose tissue expression is accompanied by reduced GLUT4 expression in HD. Renal transplantation or HDF are effective in lowering serum RBP4 levels. PMID: 29333450 Data suggest that serum levels of RBP4 and LGAL3BP are up-regulated after menopause when complicated by NAFLD (non-alcoholic fatty liver disease); RBP4 and LGAL3BP may serve as biomarkers of NAFLD in postmenopausal women. (RBP4 = retinol binding protein 4; LGAL3BP = galectin-3 binding protein) PMID: 29679552 Elevated levels of RBP4 were not associated with an increased risk of ischemic stroke among women. PMID: 28888344 Study showed that dietary weight loss-induced changes in angiotensin-converting enzyme activity, free fatty acids and RBP4 independently contribute to weight regain prediction. PMID: 29122953 RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085 the 1.5A resolution structures of human holo-RBP4 and of the protein saturated with palmitic and lauric acid and discuss the interaction of the fatty acids and retinol with the protein, are reported. PMID: 29414511 Circulating RBP4 levels may not be associated with nonalcoholic fatty liver disease. PMID: 28931435 Plasma PEDF and RBP4 identified insulin resistance in subjects with no prior diagnosis of diabetes. PMID: 28648555 Serum RBP4 level was significantly higher and closely associated with blood pressure in prehypertensive Chinese. PMID: 28639612 Conclusion RBP4 may be used as a predictive factor of diabetic nephropathy patients complicated with silent cerebral infarction (SCI) and is positively correlated with cognitive dysfunction. RBP4/Lp-PLA2/Netrin-1 pathway activation may be one of the occurrence mechanisms in diabetic nephropathy complicated with SCI. PMID: 28704853 these data demonstrate a key role of STRA6 and RBP4 in the maintenance of colon cancer self-renewal and that this pathway is an important link through which consumption of HFD contributes to colon carcinogenesis. PMID: 28689994 Data suggest that, in subjects with chronic kidney disease, renal function is inversely related to serum RBP4 levels; as GFR decreases, the relationship between RBP4 and insulin resistance is attenuated. (GFR = glomerular filtration rate, a measure of kidney function) PMID: 28473187 Results identified RBP4 as a promising acute liver failure (ALF) biomarker among energy metabolism-related proteins. RBP4 values signaled liver injury at an early stage, as its decreasing level was observed before ALT elevation in the pig ALF model, and its significant decreasing level in ALF patients. PMID: 28336726 Elevated RBP4 is detectable early in pregnancy and has strong correlation with preeclampsia and premature birth. PMID: 28338737 RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700 RBP4 may be associated with higher cardiovascular risk in overweight/obese adolescent girls, but this association is mediated by abdominal obesity. PMID: 29120147 Bi-allelic mutations in RBP4 were identified (c.248+1G>A), consistent with a diagnosis of inherited vitamin A deficiency. PMID: 27892788 Childhood obesity may be associated with variations in RBP4 gene. The presence of selective SNPs in the RBP4 gene may account for metabolic complications. PMID: 26611784 Low levels of vitamin A, E and RBP4 at the time of renal cell carcinoma diagnosis are associated with a poorer prognosis after surgery. PMID: 28668878 RBP4 is some 6-fold lower when active TB patients have chronic energy deficiency (CED) than when BMI is >25 kg/m sq; however, free fatty acids were not associated with CED in active TB patients, which may be a type 2 error or represent an energy impasse where infection and the host's metabolic needs are in competition. PMID: 28625041 Data show that the tissue-specific expression pattern of human transgenic retinol binding protein 4 (hRBP4orf) was roughly the same as that of mouse Rbp4. PMID: 28134916 Elevated levels of RBP4 are associated with higher cardiovascular mortality among men with type 2 diabetes. PMID: 27609367 RBP4 and retinol levels were increased approximately twofold in patients with chronic kidney disease. PMID: 27277845 RBP4 level was associated with increased arterial stiffness in young subjects with family history of type 2 diabetes. PMID: 26868132 Retinol-binding protein 4 is able to function as biomarker to distinguish severe pre-eclampsia from normal pregnancy. More importantly, these results may shed light on the role of Retinol-binding protein 4 in the pathogenesis in pre-eclampsia. PMID: 27279411 High level of RBP4 is associated with obesity. PMID: 26794633 The positive association between circulating RBP4 and ApoB-containing lipoproteins in a steady metabolic state, as well as during a hypocaloric diet, appears to be attenuated in patients with very high serum triglycerides. PMID: 27086684 Urinary KNG1 and RBP4 clearly respond to AKI. Additionally, RBP4 could predict recovery by monitoring this protein levels over time after AKI, as RBP4 reflects patient's normalization earlier than sCr values do. PMID: 26792617 SNPsRBP4 was associated with age at onset in familial amyloid polyneuropathy. PMID: 26286643 Serum RBP4 is negatively related to estrogen in Chinese women with obesity. PMID: 26960804 Dietary vitamin A may reduce abdominal adiposity and promote visceral to subcutaneous body fat redistribution during adolescence in an RBP4-dependent manner. PMID: 26667887 The results of this meta-analysis support the hypothesis that RBP4 is a modest independent risk factor for gestational diabetes mellitus (i.e., nonobese patients with gestational diabetes mellitus might express RBP4 at abnormal levels).The association between RBP4 rs3758539 polymorphism and gestational diabetes mellitus risk was not confirmed. PMID: 26975349 RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction. PMID: 26575118 Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio. PMID: 26069091 male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots PMID: 26619134 RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls. PMID: 26927700 Presence of gestational diabetes mellitus risk factors does not have an impact on early second trimester RBP-4 values in pregnant subjects. PMID: 25227411 This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation. PMID: 26526443 Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients. PMID: 26962819 RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres. PMID: 26425827 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance PMID: 26440092 Baseline serum RBP4 levels were independently associated with incident diabetes in Asian Indian men with impaired glucose tolerance. PMID: 25810022 Findings suggested that Asian women with gestational diabetes mellitus had increased circulating RBP4 levels in their second/third trimester. [Meta-Analysis] PMID: 25703255 Show More Hide All
Involvement in disease	Retinal dystrophy, iris coloboma, and comedogenic acne syndrome (RDCCAS); Microphthalmia, isolated, with coloboma, 10 (MCOPCB10)
Subcellular Location	Secreted.
Protein Families	Calycin superfamily, Lipocalin family
Tissue Specificity	Detected in blood plasma and in urine (at protein level).
Database Links	HGNC: 9922 OMIM: 180250 KEGG: hsa:5950 STRING: 9606.ENSP00000360519 UniGene: Hs.50223

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP019483HU
Size	$428
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC₅₀ is 695.0-970.1 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Retinol-binding protein 4(RBP4) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage