Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC₅₀ is 695.0-970.1 ng/ml.

Target Names

RBP4

Uniprot No.

P02753

Research Area

Cancer

Alternative Names

(Plasma retinol-binding protein)(PRBP)(RBP)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-201aa

Target Protein Sequence

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Mol. Weight

50.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

RBP4 serves as the principal carrier of retinol in circulation, and its interaction with transthyretin (TTR) stabilizes the complex to prevent renal filtration—making validated binding activity essential for meaningful in vitro studies. This recombinant human RBP4 (aa 19–201, full-length mature protein) demonstrates confirmed TTR-binding capacity with an EC50 of 695.0–970.1 ng/ml in functional ELISA, providing a suitable basis for ligand-binding assays, cargo-release studies, and structural or biophysical characterization of the RBP4–TTR axis. The C-terminal hFc1 tag facilitates oriented immobilization, supporting use as an ELISA standard or in antibody development campaigns targeting RBP4 in cancer-related research contexts. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for drug-protein binding studies and membrane transporter functional assays where both conformational integrity and low background interference are critical.

Code	CSB-MP019483HU
Abbreviation	Recombinant Human RBP4 protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC₅₀ is 695.0-970.1 ng/ml. Biological Activity Assay The purity of RBP4 was greater than 90% as determined by SEC-HPLC.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Retinol-binding protein 4 (RBP4) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage