Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial (Active)

In Stock
Code CSB-MP819898HU
Abbreviation Recombinant Human SECTM1 protein, partial (Active)
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml. Biological Activity Assay
  • Activity
    Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
(Protein K-12)(K12)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-145aa
Target Protein Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Mol. Weight
41.6 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human SECTM1 protein is created in mammalian cells using a plasmid containing the target gene that corresponds to the 29-145aa of the human SECTM1. The target gene is co-expressed with the C-terminal hFc-tag gene. SDS-PAGE demonstrates a purity of this SECTM1 protein exceeding 85%, and the endotoxin levels of this SECTM1 protein are below 1.0 EU/μg, as measured by the LAL method. ELISA testing confirms the SECTM1 protein's functional activity, showing its binding to the CD7 (CSB-MP004953HU) with an EC50 between 1.811 and 3.372 ng/mL. In an LSPR assay, the human CD7 protein (CSB-MP004953HU) captured on the COOH chip can bind to this human SECTM1 protein with an affinity constant of 1.84 nM.

Human SECTM1 (K12) is a transmembrane and secreted protein that plays a significant role in immune modulation and cellular signaling. It is primarily expressed in various immune cells, including T cells and NK cells, and is induced by IFN-γ [1][2][3]. SECTM1 functions as a co-stimulatory ligand for CD7, a glycoprotein found on T and NK cells, enhancing their activation and proliferation [2][4][5]. This interaction is crucial for the immune response, particularly in the context of infections and tumors, where SECTM1 can facilitate the recruitment and activation of immune cells [6][7].

In the context of cancer, SECTM1 is expressed in various malignancies, including breast and prostate cancers, where it may contribute to tumor progression by attracting monocytes through CD7-mediated signaling pathways [6][7]. Furthermore, studies have indicated that SECTM1 can enhance the expression of activation markers in NK cells, suggesting its potential utility in immunotherapy [2][5].

In addition to its role in T cell activation, SECTM1 has been implicated in various inflammatory processes. SECTM1 has been shown to promote neutrophil recruitment during lung infections, thereby contributing to the inflammatory response [8]. The protein's involvement in inflammation is further supported by its expression in conditions such as systemic sclerosis and its association with other inflammatory markers [1][3]. SECTM is also involved in the regulation of signaling pathways critical for cell survival and proliferation, such as the TGFβ/Smad pathway in glioblastoma [7].

References:
[1] T. Papadimitriou. Cd7 activation regulates cytotoxicity-driven pathology in systemic sclerosis, yielding a target for selective cell depletion, Annals of the Rheumatic Diseases, vol. 83, no. 4, p. 488-498, 2023. https://doi.org/10.1136/ard-2023-224827
[2] T. Wang, C. Huang, A. López-Coral, K. Slentz-Kesler, M. Xiao, E. Wherry, et al. K12/sectm1, an interferon-γ regulated molecule, synergizes with cd28 to costimulate human t cell proliferation, Journal of Leukocyte Biology, vol. 91, no. 3, p. 449-459, 2011. https://doi.org/10.1189/jlb.1011498
[3] Y. Li, S. Deng, X. Wang, W. Huang, J. Chen, N. Robbins, et al. Sectm1a deficiency aggravates inflammation-triggered cardiac dysfunction through disruption of lxrα signalling in macrophages, Cardiovascular Research, vol. 117, no. 3, p. 890-902, 2020. https://doi.org/10.1093/cvr/cvaa067
[4] R. Ehmann, K. Brandes, M. Antwerpen, M. Walter, K. Schlippenbach, E. Stegmaier, et al. Molecular and genomic characterization of a novel equine molluscum contagiosum-like virus, Journal of General Virology, vol. 102, no. 3, 2021. https://doi.org/10.1099/jgv.0.001357
[5] C. Georgiadis, J. Rasaiyaah, S. Gkazi, R. Preece, A. Etuk, A. Christi, et al. Base-edited car t cells for combinational therapy against t cell malignancies, Leukemia, vol. 35, no. 12, p. 3466-3481, 2021. https://doi.org/10.1038/s41375-021-01282-6
[6] T. Wang, Y. Ge, M. Xiao, A. López-Coral, L. Li, A. Roesch, et al. Sectm1 produced by tumor cells attracts human monocytes via cd7-mediated activation of the pi3k pathway, Journal of Investigative Dermatology, vol. 134, no. 4, p. 1108-1118, 2014. https://doi.org/10.1038/jid.2013.437
[7] Z. Yao. Sectm1 promotes the development of glioblastoma and mesenchymal transition by regulating the tgfβ1/smad signaling pathway, International Journal of Biological Sciences, vol. 20, no. 1, p. 78-93, 2024. https://doi.org/10.7150/ijbs.84591
[8] E. Pereira. Transcriptional profiling of sars-cov-2-infected calu-3 cells reveals immune-related signaling pathways, Pathogens, vol. 12, no. 11, p. 1373, 2023. https://doi.org/10.3390/pathogens12111373

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in thymocyte signaling.
Gene References into Functions
  1. CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
  2. SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
  3. level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells PMID: 21749909
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Protein Families
SECTM family
Tissue Specificity
Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic
Database Links

HGNC: 10707

OMIM: 602602

KEGG: hsa:6398

STRING: 9606.ENSP00000269389

UniGene: Hs.558009

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*