Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)

In Stock
Code CSB-MP819898HU
Size $228
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml. Biological Activity Assay
  • Activity
    Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Target Names
SECTM1
Uniprot No.
Research Area
Cancer
Alternative Names
(Protein K-12)(K12)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-145aa
Target Protein Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Mol. Weight
41.6 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CUSABIO cloned the coding sequence of human secreted and transmembrane protein 1 (SECTM1) (amino acids 29-145) to generate a fusion recombinant protein with the Fc portion of human IgG1 tag in mammalian cells. This recombinant SECTM1 protein is an active protein, whose bioactivity has been validated through a functional ELISA (bind to the CD7 with the EC50 of 1.811-3.372 ng/ml) and an LSPR assay (human CD7 captured on COOH chip can bind to this SECTM1 protein with an affinity constant of 1.84 nM). Its purity reaches up to 85%, measured by SDS-PAGE. Due to the glycosylation, this SECTM1 protein migrated to the molecular weight band of about 45 kDa. It contains less endotoxin, <1.0 EU/ug determined by the LAL method. It is in stock now.

SECTM1, the ligand for CD7, plays a role in the co-stimulation and proliferation of T and NK cells. It is up-regulated in many tumors, including breast cancer, prostate cancer, and some myeloid leukemias.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in thymocyte signaling.
Gene References into Functions
  1. CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
  2. SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
  3. level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells PMID: 21749909
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Protein Families
SECTM family
Tissue Specificity
Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic
Database Links

HGNC: 10707

OMIM: 602602

KEGG: hsa:6398

STRING: 9606.ENSP00000269389

UniGene: Hs.558009

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1