Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized CD7 (CSB-MP004953HU) at 5 μg/ml can bind human SECTM1, the EC50 is 1.811-3.372 ng/ml.②Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
29-145aa
Target Protein Sequence
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO cloned the coding sequence of human secreted and transmembrane protein 1 (SECTM1) (amino acids 29-145) to generate a fusion recombinant protein with the Fc portion of human IgG1 tag in mammalian cells. This recombinant SECTM1 protein is an active protein, whose bioactivity has been validated through a functional ELISA (bind to the CD7 with the EC50 of 1.811-3.372 ng/ml) and an LSPR assay (human CD7 captured on COOH chip can bind to this SECTM1 protein with an affinity constant of 1.84 nM). Its purity reaches up to 85%, measured by SDS-PAGE. Due to the glycosylation, this SECTM1 protein migrated to the molecular weight band of about 45 kDa. It contains less endotoxin, <1.0 EU/ug determined by the LAL method. It is in stock now.
SECTM1, the ligand for CD7, plays a role in the co-stimulation and proliferation of T and NK cells. It is up-regulated in many tumors, including breast cancer, prostate cancer, and some myeloid leukemias.
