Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ARID1A

Uniprot No.

O14497

Research Area

Cancer

Alternative Names

actin-dependent regulator of chromatin subfamily F member 1; ARI1A_HUMAN; ARID domain containing protein 1A; ARID domain-containing protein 1A; ARID1A; AT rich interactive domain 1A (SWI like); AT rich interactive domain 1A; AT rich interactive domain containing protein 1A; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250A; BM029; brain protein 120 ; BRG1 associated factor 250; BRG1 associated factor 250a; BRG1-associated factor 250; BRG1-associated factor 250a; C1ORF4; chromatin remodeling factor p250 ; chromosome 1 open reading frame 4; ELD; hELD; hOSA1; matrix-associated; MRD14; Osa homolog 1; OSA1; OSA1 nuclear protein ; P270; SMARCF1; SWI like protein; SWI SNF complex protein p270; SWI-like protein; SWI/SNF complex protein p270; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; SWI/SNF-related

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1976-2231aa

Target Protein Sequence

SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human ARID1A was expressed with the amino acid range of 1976-2231. The theoretical molecular weight of the ARID1A protein is 32.4 kDa. The ARID1A protein was expressed in baculovirus. The N-terminal 10xHis tag and C-terminal Myc tag was fused into the coding gene segment of ARID1A, making it easier to detect and purify the ARID1A recombinant protein in the later stages of expression and purification.

AT-rich interactive domain-containing protein 1A (ARID1A) is a highly scrutinized protein with research primarily focused on two main areas. Firstly, there is significant attention on the role of ARID1A in cancer occurrence and progression, especially concerning mutations and inactivation across various cancer types. Secondly, ARID1A's functions in genome stability and chromatin remodeling have sparked broad interest, directly implicating tumor development mechanisms. Furthermore, research on ARID1A extends to its involvement in cell cycle regulation, DNA repair, and transcriptional control. Overall, studies on ARID1A have profound implications in unraveling its contributions to cancer biology and cellular regulation.

Target Background

Function

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Gene References into Functions

Cells lacking ARID1A show enhanced AURKA transcription, which leads to the persistent activation of CDC25C, a key protein for G2/M transition and mitotic entry. PMID: 30097580
the correlation between the loss of ARID1A immunoreactivity and reduced ARID1B levels indicates that ARID1B could be an attractive target for anti-cancer therapy. PMID: 29890703
these data suggest that the combined treatment with PI3K inhibitor BKM120 and PARP inhibitor olaparib may be a promising therapeutic regimen for the treatment of gastric cancer, and ARID1A deficiency could serve as a potential predictive therapeutic biomarker. PMID: 29767248
Although Genome-Wide Association studies have not been carried out in the field of alcohol-related hepatocellular carcinoma (HCC), common single nucleotide polymorphisms conferring a small increase in the risk of liver cancer risk have been identified. Specific patterns of gene mutations including CTNNB1, TERT, ARID1A and SMARCA2 exist in alcohol-related HCC. [review] PMID: 28296015
The authors find that ARID1A has a dominant role in maintaining chromatin accessibility at enhancers, while the contribution of ARID1B is evident only in the context of ARID1A mutation. PMID: 28967863
ARID1A and human epidermal growth factor receptor-2 (Her-2) status were found to be independent prognostic factors of both overall survival (OS) and disease free survival (DFS). PMID: 28543794
ARID1A expression loss was associated with poor overall survival in Asians with gastric cancer. [meta-analysis] PMID: 27354232
the significant correlation was achieved between the negative ARID1A expression and the FIGO stage of endometrium-related gynecological cancers, but not the other characteristics. PMID: 28466574
This metaanalysis indicated that Gastric Cancer or Colorectal Cancer with ARID1A alteration might be a marker of poor prognosis. The ARID1A alteration of Gastric Cancer may result from different epigenetic factors. PMID: 28937020
Low ARID1A expression is associated with clear cell and endometrioid carcinoma of the ovary and the endometrium. PMID: 29451900
Loss of PTEN and ARID1A expression is highly specific for malignancy in effusion pathology PMID: 29170871
We propose a signaling cascade involving ARID1A, GADD45B and DUSP1 as mediators of the romidepsin effects in GCC cells. PMID: 27572311
head and neck squamous cell carcinoma patients with tumors having high level of miR-31 expression and high levels of Nanog/OCT4/Sox2/EpCAM expression, together with low level of ARID1A expression, were found to have the worst survival PMID: 27528032
loss of ARID1A leads to accumulation of ROS; elesclomol may be used to target ARID1A-mutant gynecologic cancer cells PMID: 27486766
genomic data and clinical features of four patients carrying a small 1p36.11 microduplication encompassing the complete ARID1A gene PMID: 27906199
Data show that 38 samples of 82 ovarian clear cell carcinoma (CCC) specimens presented no BAF250a expression, and 50 samples exhibited the loss of at least one subunit of the SWI/SNF complex. PMID: 27340867
Partial loss (i.e. in one tissue section some cells stained positive for BAF250a while other cells, usually an adjacent group, were negative) of BAF250a protein was identified in 36% (9/25) of rectovaginal DIE samples, 40% (2/5) of endometriosis lesions involving the PSLN, 30% (6/20) of endometriomas, and also in 25% (5/20) of endometrium from controls. PMID: 26832958
In the very high-risk Bladder Cancer patients , several genes had a higher frequency of mutations than reported in the The Cancer Genome Atlas database, including ARID1A . Mutation associations with receipt of neoadjuvant chemotherapy, nodal involvement, metastatic disease development, and survival were analyzed. PMID: 27520487
Tumors accumulate ARID1A mutations. PMID: 27172896
ARID1A silencing could significantly enhance the capability of migration and invasion in lentivirus miR-144-3p cells. PMID: 29073615
we identified concurrent ARID1A and ARID1B inactivating mutations with consequent loss of protein expression in the undifferentiated component of approximately one-quarter of dedifferentiated endometrial and ovarian carcinomas PMID: 27562491
Our study provides a novel insight into the modulatory function and mechanism of ARID1A in PI3K/AKT signaling in gastric cancer PMID: 27323812
Of the 34 undifferentiated endometrial carcinomas examined, 17 (50%) exhibited SWI/SNF complex inactivation, with 11 tumors showing complete loss of both ARID1A and ARID1B, 5 showing complete loss of BRG1 and 1 showing complete loss of INI1. Ten of the remaining 17 undifferentiated carcinomas showed the following alterations: 5 tumors (15%) showed loss of ARID1A only with intact ARID1B, BRG1, and INI1 expression. PMID: 28863077
BAF250a loss in AE is consistently associated with the development of BAF250a-negative endometriosis-associated cancers and appears to be an early event in most of these cases. PMID: 27051059
Transcriptome analysis revealed ARID1A knockdown led to miR-503 upregulation. CDKN2A was identified as a target of miR-503, which contributes to cell senescence. Thus, the data suggests that ARID1A deficiency promote KRAS(G12D)-driven pancreatic tumorigenesis through miR-503/CDKN2A-mediated senescence. PMID: 28942143
ARID1A may be a primary driver of carcinogenesis in a subset of esophageal adenocarcinomas PMID: 28440661
ARID1A mutation inactivates the apoptosis-promoting function of p53 by upregulating HDAC6, indicating that pharmacological inhibition of HDAC6 is a therapeutic strategy for ARID1A-mutated cancers. PMID: 28737768
ARID1A mutation can be an early stage event in the oncogenic transformation of endometriosis cells giving rise to ovarian clear cell carcinoma. PMID: 28483516
ARID1A expression is significantly decreased in higher stages of urothelial carcinoma and its aggressive variants. PMID: 27137986
Our data suggests that deficiency or loss of functional mutations of ARID1A in HCC cells might contribute to the increased activity of certain cancer-promoting lncRNAs. PMID: 28716731
ARID1A loss lacks prognostic significance in early stage colorectal adenocarcinoma. PMID: 26980037
ARID1A may play an important role in the early events of gastric carcinogenesis. PMID: 28031120
loss of ARID1A is more common in advanced GC and is related to EBV positivity and MMR deficiency PMID: 26067140
ARID1A protein and mRNA expression was lower in intrahepatic cholangiocarcinoma tissue than in normal liver tissue. PMID: 27433094
Most HCCs had an increased level of ARID1A mRNA. PMID: 26589513
loss of ARID1A protein expression found in TU-OC-2 cells. PMID: 26960408
Inactivating mutations in ARID1A may be involved in a novel pathway of carcinogenesis in biliary carcinomas PMID: 27334809
loss of ARID1A shortened time to cancer-specific mortality, and to recurrence of cancer when adjusting for potential confounders (Meta-Analysis) PMID: 26384299
loss of ARID1A protein expression caused by inactivating mutations reactivates TERT transcriptional activity and confers a survival advantage of tumor cells by maintaining their telomeres. PMID: 26953344
All cases with ARID1A expression are overlapped with H2B high expression. Among 15 cases with ARID1A and H2B coexpression, 13 are invasive ductal carcinoma and 2 are mucinous carcinoma. Our results indicate that ARID1A gene may be involved in carcinogenesis of some subtypes of breast cancer. PMID: 26904685
The action of ARID1A in carcinogenesis differs between adenofibroma-related clear cell carcinoma and endometriosis-related clear cell carcinoma. PMID: 25913291
we focus on the relationships of ARID1A mutations with ovarian and endometrial cancers[review] PMID: 26572704
analysis of ARID1A, CDH1, cMET and PIK3CA expression and target-related microRNA expression in gastric cancer PMID: 26334097
The loss of ARID1A was correlated with late-stage and endometriosis-associated ovarian clear cell carcinoma. ARID1A expression may predict the risk of recurrence. PMID: 26945423
Complete or partial loss of ARID1A expression is considered an independent poor prognostic factor in patients with gastric cancer. PMID: 26826411
ARID1A positively regulates Klf15 expression with PGR to inhibit epithelial proliferation at peri-implantation. Our results suggest that Arid1a has a critical role in modulating epithelial proliferation which is a critical requisite for fertility PMID: 26378916
Our results indicate that the Arid1a tumour suppressor gene has a key role in regulating ovarian endometrioid carcinoma differentiation PMID: 26279473
Arid1A role in genome-wide transcriptional regulation by SWI/SNF complexes. PMID: 26716708
Identification of this undescribed functional NLS within ARID1A contributes vital insights to rationalize the impact of ARID1A missense mutations observed in patient tumors. PMID: 26614907
Data showed that ARID1A interacts with ATR via its C-terminal region, which mediates its recruitment to DNA double-strand breaks. PMID: 26069190

Hide All

Involvement in disease

Coffin-Siris syndrome 2 (CSS2)

Subcellular Location

Nucleus.

Tissue Specificity

Highly expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and PBL, and at a much lower level in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Database Links

HGNC: 11110

OMIM: 603024

KEGG: hsa:8289

STRING: 9606.ENSP00000320485

UniGene: Hs.468972

Code	CSB-BP002058HU1
Abbreviation	Recombinant Human ARID1A protein, partial
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage