Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
actin-dependent regulator of chromatin subfamily F member 1; ARI1A_HUMAN; ARID domain containing protein 1A; ARID domain-containing protein 1A; ARID1A; AT rich interactive domain 1A (SWI like); AT rich interactive domain 1A; AT rich interactive domain containing protein 1A; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250A; BM029; brain protein 120 ; BRG1 associated factor 250; BRG1 associated factor 250a; BRG1-associated factor 250; BRG1-associated factor 250a; C1ORF4; chromatin remodeling factor p250 ; chromosome 1 open reading frame 4; ELD; hELD; hOSA1; matrix-associated; MRD14; Osa homolog 1; OSA1; OSA1 nuclear protein ; P270; SMARCF1; SWI like protein; SWI SNF complex protein p270; SWI-like protein; SWI/SNF complex protein p270; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; SWI/SNF-related
Species
Homo sapiens (Human)
Expression Region
1976-2231aa
Target Protein Sequence
SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human ARID1A was expressed with the amino acid range of 1976-2231. The theoretical molecular weight of the ARID1A protein is 32.4 kDa. The ARID1A protein was expressed in baculovirus. The N-terminal 10xHis tag and C-terminal Myc tag was fused into the coding gene segment of ARID1A, making it easier to detect and purify the ARID1A recombinant protein in the later stages of expression and purification.
AT-rich interactive domain-containing protein 1A (ARID1A) is a highly scrutinized protein with research primarily focused on two main areas. Firstly, there is significant attention on the role of ARID1A in cancer occurrence and progression, especially concerning mutations and inactivation across various cancer types. Secondly, ARID1A's functions in genome stability and chromatin remodeling have sparked broad interest, directly implicating tumor development mechanisms. Furthermore, research on ARID1A extends to its involvement in cell cycle regulation, DNA repair, and transcriptional control. Overall, studies on ARID1A have profound implications in unraveling its contributions to cancer biology and cellular regulation.