Recombinant Human Desmoplakin(DSP) ,partial

In Stock
Code CSB-EP007208HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names DSP
Uniprot No. P15924
Research Area Signal Transduction
Alternative Names 250/210 kDa paraneoplastic pemphigus antigen; DCWHKTA; Desmoplakin (DPI DPII); Desmoplakin; Desmoplakin I ; Desmoplakin II; DESP_HUMAN; DP; DP I; DP II; DPI; DPII; DSP; KPPS2; PPKS 2; PPKS2
Species Homo sapiens (Human)
Source E.coli
Expression Region 78-300aa
Target Protein Sequence CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 42.1kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes.
Gene References into Functions
  1. This study provided evidence that rs2076304 in exon 15 of the DSP gene is associated with a significantly increased risk of silicosis in a Han Chinese population. PMID: 30207747
  2. For arrhythmogenic right ventricular cardiomyopathy patients, both missense and non-missense desmoplakin mutations carry a high arrhythmic risk. PMID: 28527814
  3. Using molecular dynamics simulations, study elucidated the structural basis of post-translational modifications-induced effects. Simulations, nearing 2 mus in aggregate, indicate that phosphorylation of S2849 induces an "arginine claw" in desmoplakin's C-terminal tail. PMID: 27188911
  4. Study identified DSP to be involved in the progressive intestinal injury associated with the development of Crohn's Disease complications via its effect on intestinal intercellular intermediate filament structure binding. PMID: 28490445
  5. report for the first time in Korea on monozygotic twins with lethal acantholytic epidermolysis bullosa caused by two novel nonsense mutations in the DSP gene PMID: 28442525
  6. Double heterozygotes for mutations in DSP and MYBPC3 showed a variable clinical presentation of arrhythmogenic cardiomyopathy and hypertrophic cardiomyopathy. PMID: 28699631
  7. Study reports a DSP mutation in an association with progressive cardiac conduction disease and a high risk of sudden death. The pathogenicity of the newly identified genetic variant was confirmed by in vitro prediction analysis and familial segregation. These results suggest that the effect of the mutation might be partially due to abnormal function of ion channels as a consequence of desmosomal remodeling. PMID: 27166992
  8. DSP is a desmosomal protein critical to cell-cell adhesion in a variety of cell types and important in wound healing and epithelial barrier function. PMID: 26669357
  9. Novel desmoplakin frameshift deletion p.Thr2625fs (c.7871_7872delAC) was identified as a potential cause of heart disease and sudden cardiac death in a Polish family. PMID: 27698334
  10. This is the first report of DSP genetic screening in Chinese sudden unexplained nocturnal death syndrome (SUNDS) and Brugada syndrome. Our results imply that DSP mutations contribute to the genetic cause of some SUNDS victims and maybe a new susceptible gene for Brugada syndrome. PMID: 26585738
  11. Syndrome featuring erythrokeratodermia and cardiomyopathy (EKC) caused by mutation in DSP was described. Specific region of DSP protein critical to the pathobiology of EKC syndrome and to DSP function in the heart and skin was identified. PMID: 26604139
  12. novel de novo heterozygous missense mutation caused severe dermatitis, multiple allergies, and metabolic wasting syndrome PMID: 26073755
  13. There is higher incidence of Myocarditis in DSP mutation carriers affected by Arrhythmogenic right ventricular dysplasia. PMID: 25616123
  14. Case Reports: desmoplakin mutations associated with variable woolly hair or hypotrichosis, palmoplantar keratoderma, and cardiac manifestations. PMID: 25227139
  15. Genetic testing revealed a novel combination of two heterozygous mutations in the DSP gene encoding desmoplakin PMID: 25516398
  16. Case Report: PKP2/DSP mutations in patient with Brugada syndrome and ventricular tachycardia. PMID: 25900994
  17. Patients whose MPM tissues expressed elevated mRNA levels of BIRC5, DSP, NME2, and THBS2 showed a statistically significant shorter overall survival. PMID: 25771974
  18. GSK3- and PRMT-1-dependent modifications of desmoplakin control desmoplakin-cytoskeleton dynamics. PMID: 25733715
  19. our data indicate that DP phosphorylation at S2849 represents an important mechanism in pemphigus pathogenesis PMID: 25010392
  20. a subset of arrhythmogenic cardiomyopathy mutations, in addition to a mutation associated with skin fragility/woolly hair syndrome, impair gap junction localization and function by misregulating DP-EB1 interactions and altering microtubule dynamics. PMID: 25225338
  21. Arrhythmogenic right ventricular cardiomyopathy patients of a three-generation Spanish family with a novel nonsense genetic variation in the DSP gene. PMID: 23954618
  22. The cardiomyopathy mechanisms varied accordingly to the specific types of DSP mutation identified and included haploinsufficiency, dominant-negative effects, or a combination hereof. PMID: 23137101
  23. DSP is inactivated in lung cancer by an epigenetic mechanism, increases the sensitivity to anticancer drug-induced apoptosis and has tumor-suppressive function, possibly through inhibition of the Wnt/beta-catenin signaling pathway in NSCLC cells. PMID: 22791817
  24. DSP splice variant is crucial for desmosome-mediated adhesion in HaCaT keratinocytes. PMID: 22454510
  25. In two unrelated patients with Naxos-Carvajal syndrome, a single heterozygous de novo mutation in the desmoplakin gene DSP, p.Leu583Pro and p.Thr564Ile, leading to severe phenotypes was found. PMID: 22949226
  26. Desmoplakin disease causes connexin mislocalization in the mouse & man preceding overt histological abnormalities resulting in significant alterations in conduction repolarization kinetics prior to morphological changes detectable on cardiac imaging PMID: 22240500
  27. Desmoplakin and pGSK3beta constitute independent good prognostic factors for progression free survival in Ewing Sarcoma patients. PMID: 22898789
  28. desmoplakin is a promising candidate for supportive CSF marker to rule out 14-3-3 false positive cases in sporadic Creutzfeldt-Jakob disease differential diagnosis. PMID: 22213780
  29. desmoplakin I levels, determined within 1-3 months of the first ischemic stroke, could be a biomarker for statin responsiveness against a new vascular event in post-ischemic stroke patients taking statins PMID: 22304020
  30. Palmitate significantly reduces DSP expression, and treatment with insulin restores the lost expression of DSP. PMID: 22132232
  31. Case Report: desmoplakin mutation responsible for juvenile biventricular cardiomyopathy with left ventricular non-compaction and acantholytic palmoplantar keratoderma. PMID: 21789513
  32. DP Ser2849Gly promotes hyperadhesion PMID: 21993560
  33. We detected a novel mutations: DSP T1373A and it may be associated with a risk for tachycardia PMID: 21397041
  34. A novel nonsense mutation in the desmoplakin gene and the truncated protein which it produces caused left dominant arrhythmogenic cardiomyopathy PMID: 21458130
  35. Mutations in desmoplakin protein is associated with cardiomyopathy. PMID: 21756917
  36. Full sequencing of the DSP showed a novel homozygous c.7097 G>A (p.R2366H) mutation in all skin fragility-woolly hair syndrome affected family members. PMID: 20738328
  37. intimate intramolecular association of the SH3 domain with the preceding SR is also observed in plectin, another plakin protein suggesting that the SH3 domain of plakins contributes to the stability and rigidity of this subfamily of SR-containing proteins PMID: 21536047
  38. SERCA2-deficient cells exhibited up to a 60% reduction in border translocation of desmoplakin (DP), the desmosomal cytolinker protein necessary for intermediate filament (IF) anchorage to sites of robust cell-cell adhesion PMID: 21156808
  39. autosomal-dominant mutations in the DSP gene are associated with hypo/oligodontia in the setting of Carvajal/Naxos syndrome PMID: 20940358
  40. A novel minor isoform of desmoplakin that is also produced by alternative splicing of the desmoplakin gene, is described. PMID: 20524011
  41. we describe a combination of DP mutation phenotypes affecting the skin, heart, hair, and teeth PMID: 19924139
  42. Lethal acantholytic epidermolysis bullosa (LAEB) is an autosomal recessive disorder caused by mutations in the gene encoding the desmosomal protein, desmoplakin (DSP) PMID: 19945626
  43. Compound heterozygosity for non-sense and mis-sense mutations in desmoplakin underlies skin fragility/woolly hair syndrome. haploinsufficiency PMID: 11841538
  44. non-small cell lung carcinoma subtypes have specific patterns of desmoplakin 1 and 2 and cytokeratin 18 gene expression, protein content and biodistribution PMID: 11955647
  45. Mutation (S299R) in exon 7 of desmoplakin causes arrhythmogenic right ventricular cardiomyopathy, unlinked to other causes. PMID: 12373648
  46. desmoplakin has a role in capillary formation PMID: 15190119
  47. Naxos disease is not caused by the desmoplakin gene mutation in an arab family. PMID: 15494820
  48. the involvement of desmoplakin (DP), plectin, and periplakin in the destruction of epithelial cell integrity ensures the efficient elimination of cytoskeleton, but also provides specificity for selectively targeting individual adhesion molecules PMID: 15500642
  49. dominant mutation in desmoplakin that causes left-sided arrhythmogenic left ventricular cardiomyopathywith arrhythmias of left ventricular origin. PMID: 16061754
  50. dramatic phenotype, which we named "lethal acantholytic epidermolysis bullosa," underscores the paramount role of desmoplakin in epidermal integrity PMID: 16175511
  51. Our data are consistent with the idea that DP assembles into nascent junctions from both diffusible and particulate pools in a temporally overlapping series of events triggered by cell-cell contact and regulated by actin and DP-IF interactions. PMID: 16365169
  52. This is the first description of a phenotype caused by a mutation affecting only one DSP isoform. PMID: 16467215
  53. A novel insertion mutation in desmoplakin is associated with early death from cardiomyopathy in a family with dominant striate palmoplantar keratoderma and wooly hair. PMID: 16628197
  54. Mutation analysis of 66 arrhythmogenic right ventricular dysplasia/cardiomyopathy patients identified 4 variants in DSP; V30M, Q90R, W233X, and R2834H. A cause and effect relationship between those DSP missense mutations and ARVD/C was extablished. PMID: 16917092
  55. Dp may participate in the regulation of keratinocyte cell proliferation by, in part at least, regulating cell cycle progression PMID: 17475244
  56. The Ki67+ proliferation index was inversely correlated with desmoplakin and plakophilin-1 during cervical squamous cell carcinogenesis PMID: 17593084
  57. Loss-of-function mutations in the DSP gene can result in a phenotype similar to ectodermal dysplasia-skin fragility syndrome resulting from PKP1 mutations but only DSP pathology is associated with cardiac disease PMID: 19016709
  58. Three proteins were significantly elevated in PTB cases: desmoplakin isoform 1, stratifin, and thrombospondin 1 precursor, providing a foundation for further validation in larger patient cohorts. PMID: 19271751
  59. Altered DSP expression at transcriptional and protein levels provides prognostic information in human oropharyngeal cancer. PMID: 19386346

Show More

Hide All

Involvement in disease Keratoderma, palmoplantar, striate 2 (SPPK2); Cardiomyopathy, dilated, with woolly hair and keratoderma (DCWHK); Arrhythmogenic right ventricular dysplasia, familial, 8 (ARVD8); Skin fragility-woolly hair syndrome (SFWHS); Epidermolysis bullosa, lethal acantholytic (EBLA); Cardiomyopathy, dilated, with woolly hair, keratoderma, and tooth agenesis (DCWHKTA)
Subcellular Location Cell junction, desmosome, Cytoplasm, cytoskeleton, Cell membrane
Protein Families Plakin or cytolinker family
Tissue Specificity Isoform DPI is apparently an obligate constituent of all desmosomes. Isoform DPII resides predominantly in tissues and cells of stratified origin.
Database Links

HGNC: 3052

OMIM: 125647

KEGG: hsa:1832

STRING: 9606.ENSP00000369129

UniGene: Hs.519873

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1