Recombinant Human G1/S-specific cyclin-D2(CCND2)

Code CSB-EP004812HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CCND2
Uniprot No. P30279
Research Area Cell Biology
Alternative Names CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-289aa
Target Protein Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 60.1kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).
Gene References into Functions
  1. GACAT3 promotes breast cancer malignancy by sponging miR-497, leading to the enhancement of its endogenous target CCND2. These results suggest that GACAT3/miR-497/CCND2 is a potential therapeutic target and biomarker for breast cancer PMID: 29945347
  2. Our results indicate that miR-4317 can reduce Non-small cell lung cancer (NSCLC) cell growth and metastasis by targeting FGF9 and CCND2. These findings provide new evidence of miR-4317 as a potential non-invasive biomarker and therapeutic target for NSCLC. PMID: 30227870
  3. miR-29b suppressed cellular proliferation and promoted apoptosis of pulmonary artery smooth muscle cells, possibly through the inhibition of Mcl-1 and CCND2. PMID: 29662889
  4. Our results provide novel insights into the function of EBNA3C on cell progression by regulating the cyclin D2 protein and raise the possibility of the development of new anticancer therapies against EBV-associated cancers. PMID: 29997218
  5. present study provides novel insight into the genetics of myeloid malignancies, namely Philadelphia-negative neutrophilic leukemias. Our work suggests that in addition to the commonly recurring classes of genes that are frequently mutated in these malignancies, recurrent mutations in cyclin D2, and perhaps other cell cycle regulators, have biochemical and therapeutic consequences and may play important roles in the pathog PMID: 28630439
  6. focal gain of CCND2 and adjacent regions was seen in 8 of 9 (89%) gemistocytic IDH mutant astrocytomas PMID: 28000032
  7. data indicate that linc00598 plays an important role in cell cycle regulation and proliferation through its ability to regulate the transcription of CCND2. PMID: 27572135
  8. NAV2 and CCND2 are novel candidate prognostic markers in uterine leiomyosarcoma and uterine low-grade endometrial stromal sarcoma, respectively. PMID: 28643014
  9. The surface immune molecule CD274 plays a critical role in the proliferation of leukemia-initiating cells, LICs. The CD274/JNK/Cyclin D2 pathway promotes the cell cycle entry of LIC. PMID: 27855694
  10. High CCND2 expression is associated with Metastasis of Colorectal Cancer. PMID: 28933597
  11. Mutation in the CCND2 gene is associated with acute myeloid leukemia. PMID: 27843138
  12. data suggested that loss of CCND2 expression is closely associated with the promoter aberrant methylation PMID: 27583477
  13. MiR-497 significantly suppressed cell proliferation by arresting the cell cycle through the CCND2 protein. PMID: 27918592
  14. cyclin D2 acts as regulator of cell cycle proteins affecting SAMHD1-mediated HIV-1 restriction in non-proliferating macrophages. PMID: 27541004
  15. CCND2-AS1 promotes glioma cells proliferation and growth in a process that involves Wnt and beta-catenin PMID: 27923660
  16. CCND1 is downregulated, whereas CCND2 is not, following ionizing radiation (IR) . Both CCND1- and CCND2-expressing MM cells arrested in S/G2/M, and did not differ in other cell-cycle proteins or sensitivity to IR.Differential expression of D-cyclin does not appear to affect cell-cycle response to IR, and is unlikely to underlie differential sensitivity to DNA damage. PMID: 27146121
  17. Bioinformatics analysis further revealed cyclin D2 (CCND2) and AKT3, putative tumor promoters, as potential targets of miR610. Data from reporter assays showed that miR610 directly binds to the 3'untranslated PMID: 26782072
  18. this study shows that miR-124-3p may negatively regulate the transcription of the STAT3 by interfering with its 3'UTR, and the degradation of STAT3 affects its downstream expression of such as p-STAT3, CCND2 and MMP-2 PMID: 26707908
  19. these results highlight the impact of CCND2 3'UTR shortening on miRNA-dependent regulation of CCND2 in multiple myeloma. PMID: 26341922
  20. The results do not support our hypothesis that common germline genetic variants in the CCND2 genes is associated with the risk of developing medulloblastoma. PMID: 26290144
  21. miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2. PMID: 26225959
  22. CCND2 was identified as a putative target gene for SMYD3 transcriptional regulation, through trimethylation of H4K20.Our results support a proto-oncogenic role for SMYD3 in prostate carcinogenesis, mainly due to its methyltransferase enzymatic activity. PMID: 25980436
  23. Up-regulation of clyclinD2 regulates laryngeal squamous cell carcinoma cell growth. PMID: 26221902
  24. Treatment of rSCC-61 and SCC-61 with the DNA hypomethylating agent 5-aza-2'deoxycitidine increased CCND2 levels only in rSCC-61 cells, while treatment with the control reagent cytosine arabinoside did not influence the expression of this gene PMID: 25961636
  25. miR206 inhibits glioma progression via the regulation of cyclinD2 and that miR206 may be a novel biomarker with potential for use as a therapeutic target in gliomas. PMID: 25572712
  26. the dysregulation of miR-206-CCND2 axis may contribute to the aggressive progression and poor prognosis of human gastric cancer. PMID: 25960238
  27. OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3. PMID: 25673160
  28. Cyclin D2 hypermethylation is associated with breast cancer. PMID: 25824739
  29. Methylation changes were enriched in MSX1, CCND2, and DAXX at specific loci within the hippocampus of patients with schizophrenia and bipolar disorder. PMID: 25738424
  30. Study establishes that a low-frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion. PMID: 25605810
  31. Stepwise Cox regression modelling suggested that the methylation of genes HSPB1, CCND2 and DPYS contributed objective prognostic information to Gleason score and PSA with respect to prostate cancer-related death. PMID: 25193387
  32. study establishes that a low frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion PMID: 25605810
  33. results provide evidence that CCND2 polymorphism rs3217927 may be involved in the etiology of childhood ALL, and the GG genotype of rs3217927 may modulate the genetic susceptibility to childhood ALL in the Chinese population. PMID: 24743557
  34. miR-154 plays a prominent role in prostate cancer proliferation by suppressing CCND2 PMID: 23428540
  35. Together, this study has uncovered a positive role of cyclin D2 in hepatitis B virus replication. PMID: 24992041
  36. De novo CCND2 mutations leading to stabilization of cyclin D2 cause megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome. PMID: 24705253
  37. Study reveals molecular insight into how the Ets family transcription factor Pea3 favors EMT and contributes to tumorigenesis via a negative regulatory loop with Cyclin D2, a new Pea3 target gene. PMID: 23989931
  38. A low-frequency (1.47%) variant in intron 1 of CCND2, rs76895963[G], reduces risk of type 2 diabetes by half (odds ratio (OR) = 0.53, P = 5.0 x 10(-21)) and is correlated with increased CCND2 expression. PMID: 24464100
  39. Frequent aberrations of CCND2 and RB1 is associated with intracranial germ cell tumors PMID: 24249158
  40. our results demonstrate that cyclin D2 has a critical role in cell cycle progression and the tumorigenicity of glioblastoma stem cells PMID: 22964630
  41. Cyclin D2 is a direct target of miR-206 in breast cancer cells PMID: 23466356
  42. Experimental verification of the ability of this small RNA molecule to regulate the expression of CCND2, a gene with documented oncogenic activity, confirms its functional role as a miRNA. PMID: 22954617
  43. CCND2 gene polymorphism is associated in the pathogenesis of colorectal cancers. PMID: 23266556
  44. miR-206 could suppress gastric carcinoma cell proliferation at least partially through targeting cyclinD2 expression. PMID: 23348698
  45. Chromosomal rearrangements of the CCND2 locus were detected in 55% of the cases, with an IG gene as partner in 18 of 22, in particular with light chains (10 IGK@ and 5 IGL@)for mantle cell lymphoma. PMID: 23255553
  46. Transgenic K562 cells have distinct gene expression profiles both in steady state and during terminal erythroid differentiation, with GATA1s expression characterised by lack of repression of MYB, CCND2 and SKI. PMID: 22853316
  47. CCND2, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined. PMID: 22048254
  48. High expression of cyclin D2 is associated with mantle cell lymphoma. PMID: 21479697
  49. Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus. PMID: 22004425
  50. The authors demonstrate that Cyclin D2 is also expressed in the developing human cortex within similar domains, thus indicating that its role as a fate determinant is ancient and conserved. PMID: 22395070
  51. FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation. PMID: 22323446
  52. Downregulation of miR-1, -206 and -29 stabilizes the expression of PAX3 and CCND2 in both embryonal and alveolar rhabdomyosarcoma. PMID: 22330340
  53. Cyclin D2 is overexpressed in the proliferation centers of CLL/SLL and this is due, in part, to the upregulation of NF-kappaB-related pathways. PMID: 21790895
  54. Major regulator of CCND2 expression in pancreatic beta cells is glucose acting via glycolysis and calcium channels; glucose up-regulates nuclear CCND2 in quiescent cells and down-regulates CCND2 in replicating cells. PMID: 21521747
  55. High cyclin D2 is associated with higher grade (III and IV) of astrocytoma. PMID: 20077038
  56. Authors present a CD5-positive, CCND1-negative B-cell lymphoma with a novel translocation involving CCND2 and the immunoglobulin lambda (IGL) gene. PMID: 21504716
  57. Valproic acid could down-regulate mRNA expression of cyclin D2 in the kasumi-1 leukemic cell line. PMID: 19379567
  58. the 3'UTR of E2F2 and CCND2 were directly bound to let-7a and let-7a down-regulated the expression of E2F2 and CCND2, suppressing prostate cancer cell proliferation in culture PMID: 20418948
  59. sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma PMID: 21059263
  60. Our result supported the finding that ubiquitin-specific protease 22 can interact with cyclin D2 and active cyclin D2 activity. PMID: 21039844
  61. hypermethylation in tumors from non-small cell lung cancer patients is associated with gender and histologic type PMID: 19945765
  62. High level of CCND2 expression is associated with nasopharyngeal carcinoma. PMID: 20473882
  63. Zinc can accelerate the proliferation and DNA reproduction of cord blood-derived mesenchymal stem cells and increase the contents of cyclin D2, CDK4, and cellular total protein. PMID: 20939487
  64. One common polymorphism in the 5'-untranslated region (that is, rs1049606) and the most common haplotype (CCND-ht1 [T-C-T-A-T]), however, were significantly associated with hepatatis B virus clearance. PMID: 20414251
  65. In colorectal adenocarcinoma expression of cyclin D2 at the margin was associated with vascular invasion, lymph node metastasis and liver metastasis PMID: 19508551
  66. Tax-induced cell-cycle progression in T cells is mediated, at least in part, through cell-type-specific activation of the cyclin D2 and cdk6 genes through NF-kappaB and may be important for the cell-type-specific oncogenesis. PMID: 18504428
  67. study suggests that downstream signaling components of the PI3K/Akt pathway, GSK3 & cyclin D2 as well as the significant interaction between PTEN-PDK and between pAkt-pGSK3beta, are involved in the survival and proliferation of leiomyomas. PMID: 19464003
  68. the knockdown of cyclin D1 is compensated by the upregulation of cyclin D2, a more powerful strategy would be to inhibit both cyclin D1 and cyclin D2. PMID: 19679881
  69. cyclin D2+ cells represent a pool of leukemic cells with the potential to enter the dividing compartment. PMID: 20066902
  70. Data show that methylation of CCND-2, p16, RAR-beta and RASSF-1a was significantly more prevalent in tumor than in normal tissue specimens. PMID: 19618401
  71. Overexpression of cyclin D2 is associated with increased in vivo invasiveness of human squamous carcinoma cells. PMID: 12112307
  72. cyclin d2 hypermethylation associated with loss of cyclin d2 expression in subset of gastric cancer PMID: 12771922
  73. results show that cyclin D2 is complexed with p27, leading to a model for testicular germ cell tumors whereby the overexpression of cyclin D2 leads to the functional sequestration of p27 in the presence of CCNE and CCND2, favoring cell proliferation PMID: 12777997
  74. methylation of Cyclin D2 in prostate cancers correlates with clinicopathological features of poor prognosis PMID: 14581343
  75. hypermethylated in invasive and in in situ lobular breast cancer PMID: 14601057
  76. DNA hypomethylation is a mechanism underlying the increased expression of cyclin D2 in cancer cells and demethylation of cyclin D2 may be involved in development and progression of gastric carcinoma PMID: 14612939
  77. p21/cyclin D2/cdk4 complex is not an inhibitory complex for the cyclin D2/cdk4 complex in HTLV-1 infected cells. PMID: 15169570
  78. E2 may stimulate the growth of keratinocytes by inducing cyclin D2 expression via CREB phosphorylation by protein kinase A, dependent on cAMP. PMID: 15245432
  79. This suggests that dysregulation of CCND2 and CDK4 plays a specific role in WT tumorigenesis. PMID: 15797629
  80. the recurrent T-ALL-associated t(12;14) results in overexpression of cyclin D2 PMID: 16548914
  81. Cyclin D2 promoter methylation and gene silencing may play an important functional role in prostate carcinogenesis. PMID: 17016690
  82. cyclin D2 expression in normal and malignant hematopoietic cells is regulated by ubiquitin/proteasome-dependent degradation triggered by Thr280 phosphorylation by GSK3beta or p38, which is induced by inhibition of the PI3K pathway PMID: 17486076
  83. Responsible for neoplastic cell transformation when coexpressed with an activated Ras protein. PMID: 17873913
  84. cyclin E expression in 2 t(11;14)-negative mantle cell lymphomas characterized by a cryptic t(2;14)(p24;q32) and identification of MYCN as a new lymphoma oncogene associated with a blastoid mantle cell lymphoma PMID: 18391076
  85. Forty one percent of breast cancers were associated with methylation of cyclin d2. PMID: 18483325
  86. All three D-type cyclins promoted robust hepatocyte proliferation and marked liver growth, although cyclin D3 stimulated less DNA synthesis than D1 or D2. PMID: 18635970
  87. in response to cellular activation in T cells and B cells, a PTB-containing stability complex forms that contains binding sites for Rab8A and cyclin D(2) transcripts and increases their mRNA half-lifes PMID: 18714005
  88. a pattern of translocalization suggests a spatial separation of the cyclin D-Cdk complex from pRb and DNA in the nucleus to regulate the G1-S transition PMID: 18827403
  89. These results suggest that miR-302b plays an important role in maintaining the pluripotency of embryonal carcinoma cells and probably embryonic stem cells , by post-transcriptional regulation of Cyclin D2 expression. PMID: 18930031
  90. restoration of CCND2 expression potentially prevents the carcinogenesis of prostate cancer, which is mostly androgen receptor -dependent in the initial settings. PMID: 19577536
  91. As a result of the mantle cell lymphoma translocation, cycD2 mRNA was highly over-expressed when compared with normal lymphoid tissue and other B-cell non-Hodgkin's lymphomas PMID: 19608671
  92. data presented here indicate that cD2 is not necessary for cortical intermediate progenitor cells (IPCs) to emerge but that cD2 is used in progenitors as they transition into and expand their IPC numbers PMID: 19641124
  93. Cyclin D2 and the CDK substrate p220(NPAT) are required for self-renewal of human embryonic stem cells. PMID: 19890848

Show More

Hide All

Involvement in disease Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3)
Subcellular Location Nucleus, Cytoplasm, Membrane
Protein Families Cyclin family, Cyclin D subfamily
Database Links

HGNC: 1583

OMIM: 123833

KEGG: hsa:894

STRING: 9606.ENSP00000261254

UniGene: Hs.376071

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1