Recombinant Human Junctional adhesion molecule B(JAM2),partial

Code CSB-EP011936HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names JAM2
Uniprot No. P57087
Research Area Cardiovascular
Alternative Names C21orf43; CD 322; CD322; CD322 antigen; JAM 2; JAM B; JAM IT/VE JAM; JAM; vascular endothelial; JAM-2; JAM-B; JAM2; JAM2_HUMAN; JAMB; Jcam2; Junction adhesion molecule 2; Junction adhesion molecule B; Junctional adhesion molecule 2; Junctional adhesion molecule B; PRO 245; PRO245; Vascular endothelial junction associated molecule; Vascular endothelial junction-associated molecule; VE JAM; VE-JAM; VEJAM
Species Homo sapiens (Human)
Source E.coli
Expression Region 29-238aa
Target Protein Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 27.5kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
Gene References into Functions
  1. this review briefly focuses on what is currently known about the structure, function, and mechanism of JAM-B, with particular emphasis on cancer. [review] PMID: 27121546
  2. JAM-2 may function as a putative tumour suppressor in the progression and metastasis of colorectal cancer PMID: 26782073
  3. This study showed thatJAM2 (rs2829841; intronic), associated with Alzheimer disease. PMID: 25649652
  4. Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells. PMID: 24357068
  5. These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma PMID: 23277282
  6. role as an adhesive ligand for interacting with a variety of immune cell types PMID: 11823489
  7. interacts with alpha4beta1; Facilitation by JAM3 PMID: 12070135
  8. Results suggest a role for junctional adhesion molecule-2 (JAM-2) in facilitating transmigration in endothelial cells PMID: 12476045
  9. Examine JAM-2 expression in normal/inflammed lymphatic endothelium. PMID: 17822725
  10. Discovery as ligand for the integrin alpha4beta1 PMID: 12070135
  11. Cloning and discovery as adhesion receptor for T cells PMID: 10945976

Show More

Hide All

Subcellular Location Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.
Database Links

HGNC: 14686

OMIM: 606870

KEGG: hsa:58494

STRING: 9606.ENSP00000420419

UniGene: Hs.517227

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1