Recombinant Human Junctional adhesion molecule B(JAM2),partial

Code CSB-YP011936HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P57087
Relevance May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Junctional adhesion molecule 2 ;JAM-2Vascular endothelial junction-associated molecule ;VE-JAM; CD322
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Research Area Cardiovascular
Source Yeast
Gene Names JAM2
Protein Names Recommended name: Junctional adhesion molecule B Short name= JAM-B Alternative name(s): Junctional adhesion molecule 2 Short name= JAM-2 Vascular endothelial junction-associated molecule Short name= VE-JAM CD_antigen=
Expression Region 29-238aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
Subcellular Location Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.
Database Links

HGNC: 14686

OMIM: 606870

KEGG: hsa:58494

STRING: 9606.ENSP00000420419

UniGene: Hs.517227

Pathway Leukocyte transendothelial migration

Related Products

JAM2 Antibodies

JAM2 Antibodies for Human

JAM2 Antibodies for Homo sapiens (Human)

JAM2 Proteins

JAM2 Proteins for Homo sapiens (Human)

JAM2 ELISA Kit

JAM2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.