Recombinant Human Junctional adhesion molecule B(JAM2)

Product Type Recombinant Protein
Uniprot No. P57087
Species Homo sapiens (Human)
Research Area Cardiovascular
Gene Names JAM2
Protein Names Recommended name: Junctional adhesion molecule B Short name= JAM-B Alternative name(s): Junctional adhesion molecule 2 Short name= JAM-2 Vascular endothelial junction-associated molecule Short name= VE-JAM CD_antigen=
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Target Details Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types and may play a role in lymphocyte homing to secondary lymphoid organs.
HGNC 14686
RGD 1561692
MGI 1933820
Function May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
Subcellular Location Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.
Database Links

HGNC: 14686

OMIM: 606870

KEGG: hsa:58494

STRING: 9606.ENSP00000420419

UniGene: Hs.517227

Pathway Leukocyte transendothelial migration

Product Details for Different Expression Systems

Product Name Recombinant Human Junctional adhesion molecule B(JAM2),Baculovirus
Code CSB-BP011936HU
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Expression Region 29-238aa
Protein Description Extracellular domain
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Junctional adhesion molecule B(JAM2),Mammalian cell
Code CSB-MP011936HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Expression Region 29-238aa
Protein Description Extracellular domain
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

JAM2 Antibodies

JAM2 Antibodies for Human

JAM2 Antibodies for Homo sapiens (Human)

JAM2 Proteins

JAM2 Proteins for Homo sapiens (Human)

JAM2 ELISA Kit

JAM2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.