Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)

Code CSB-EP351810HU1e1
Product Type Recombinant Protein
Size US$1892
Uniprot No. P62937
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Research Area Immunology
Source E.coli
Gene Names PPIA
Expression Region 2-165aa
Tag Info Tag-Free
Mol. Weight 17.9 kDa
Protein Description Full Length of Mature Protein
Storage "The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃."
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Subcellular Location Cytoplasm, Secreted
Protein Families Cyclophilin-type PPIase family, PPIase A subfamily
Database Links

HGNC: 9253

OMIM: 123840

KEGG: hsa:5478

STRING: 9606.ENSP00000419425

UniGene: Hs.356331

Pathway Necroptosis

Related Products

PPIA Antibodies

PPIA Antibodies for Homo sapiens (Human)

PPIA Antibodies for Human

PPIA Proteins

PPIA Proteins for Homo sapiens (Human)

PPIA ELISA Kit

PPIA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.