Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
transcription factor spi1; 31 kDa Transforming Protein; 31 kDa-transforming protein; cb1086; Hematopoietic transcription factor PU.1; OF; oncogene spi1; PU.1; SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of; SFPI1; si:by184l24.2; SPI 1; SPI 1 proto oncogene; SPI A; Spi1; SPI1_HUMAN; Spleen focus forming virus (SFFV) proviral integration oncogene spi1; Spleen focus forming virus proviral integration oncogene spi1; Transcription factor PU.1
Species
Homo sapiens (Human)
Expression Region
1-270aa
Target Protein Sequence
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To make this Recombinant Human SPI1 protein, the SPI1 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human SPI1 protein was developed in the platform. It was expressed in E.coli at the region of 1-270aa of the Human SPI1 protein. N-terminal 6xHis tag was fused with the expression vector for affinity and purification purposes. The purity is 85%+ determined by SDS-PAGE.
SPI1 gene encodes the hematopoietic master TF PU.1. Previous studies define the clinical and molecular phenotype of this novel inherited PU.1 haploinsufficiency syndrome, which they term PU.1-mutated agammaglobulinemia (PU.MA). PU.1 is a key transcriptional regulator required in the development of multiple hematopoietic lineages. Somatic mutations in SPI1 have been reported in the context of acute myeloid leukemia. However germline variants impacting human SPI1 have not been previously identified. Mouse models of Spi1-deficient hematopoiesis indicate a crucial role for PU.1 in early lineage commitment, differentiation of multiple myeloid lineages, as well as B cell development. However, the precise effect of SPI1 loss on human hematopoiesis has remained unknown. PU.1 has been shown to have multifaceted roles in hematopoiesis, with reduced PU.1 levels causing B cell developmental arrest, but other specific PU.1 perturbations can favor B cell over myeloid lineage development.