Recombinant Human Transcription factor PU.1(SPI1)

In Stock
Code CSB-EP022567HU
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022567HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPI1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022567HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPI1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names SPI1
Uniprot No. P17947
Research Area Immunology
Alternative Names transcription factor spi1; 31 kDa Transforming Protein; 31 kDa-transforming protein; cb1086; Hematopoietic transcription factor PU.1; OF; oncogene spi1; PU.1; SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of; SFPI1; si:by184l24.2; SPI 1; SPI 1 proto oncogene; SPI A; Spi1; SPI1_HUMAN; Spleen focus forming virus (SFFV) proviral integration oncogene spi1; Spleen focus forming virus proviral integration oncogene spi1; Transcription factor PU.1
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-270aa
Target Protein Sequence MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 35.1kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing (By similarity).
Gene References into Functions
  1. these results suggest that attenuating PU.1 may be a valid therapeutic approach to limit microglial-mediated inflammatory responses in Alzheimer's disease PMID: 30124174
  2. PU.1 3'UTR attenuates TNFalphainduced proliferation and cytokine release of RAFLS by acting as a ceRNA for FOXO3 to regulate miR155 activity. PMID: 29693176
  3. Inhibition of endogenous miR-155 in B cells of rheumatoid arthritis patients restores PU.1 and reduces production of antibodies. PMID: 27671860
  4. PU.1 binds to OX40L promoter in dendritic cells. PMID: 27708417
  5. These results bring indirect evidence that leukemia develops from cells which have bypassed Spi1-induced senescence. Overall, our results reveal senescence as a Spi1-induced anti-proliferative mechanism that may be a safeguard against the development of acute myeloid leukemia. PMID: 28912174
  6. In contrast, expression of Spi1/PU.1 in a Fli1 producing erythroleukemia cell line in which fli1 is activated, resulted in increased proliferation through activation of growth promoting proteins MAPK, AKT, cMYC and JAK2 PMID: 28586009
  7. Data show that protein phosphatase-1 alpha (PP1alpha) is required to maintain checkpoint kinase 1 (CHK1) in a dephosphorylated state and for the accelerated replication fork progression in Spi1/PU.1 transcription factor-overexpressing cells. PMID: 28415748
  8. the results indicate that PU.1 may be a critical factor for the innate defense against A. fumigatus, and may therefore be a potential target for the prophylaxis and treatment of IPA. PMID: 28440496
  9. PU.1 supports TRAIL-induced cell death by inhibiting RelA-mediated cell survival and inducing DR5 expression. PMID: 28362429
  10. PU.1 directly activates the expression of HOTAIRM1 through binding to the regulatory region of HOTAIRM1 during granulocytic differentiation. PMID: 27146823
  11. PU.1 and IL-9 may play a role in AD pathogenesis and relate to disease severity and clinical eruption types. PMID: 28229452
  12. PU.1 has a role in tumor suppression in PEL and its down-regulation is associated with PEL development. PMID: 28481873
  13. PU.1-induced apoptosis in myeloma cells is associated with IRF4 downregulation and subsequent IRF7 upregulation. PMID: 28368411
  14. Most cases of histiocytic sarcoma expressed histiocytic markers CD68 (6 of 7 cases), CD163 (5 of 5 cases), and PU.1 (3 of 4 cases). PMID: 28805986
  15. findings highlight a unique role of SPI1 fusions in high-risk pediatric T cell acute lymphoblastic leukemia PMID: 28671687
  16. Alzheimer's disease heritability was enriched within the PU.1 cistrome, implicating a myeloid PU.1 target gene network in AD. PMID: 28628103
  17. expression of an essential mediator of neutrophil terminal differentiation, the ets transcription factor PU.1, was significantly decreased in Hbb(th3/+) neutrophils in beta-thalassemia PMID: 28325862
  18. RUNX1 overexpression induced partial DNA demethylation at SPI1 proximal promoter. PMID: 28376714
  19. This study demonstrated the novel role of PU.1 in the immune response to A. fumigatus through upregulation of Dectin-1 expression and its translocation to the nucleus in A. fumigatus-stimulated THP-1 cells. PMID: 27306059
  20. PU.1 is an important modulator of VDR signaling in monocytes. PMID: 28232093
  21. Forced FOG1 protein expression in K562 erythroleukemia cells induced the expression of SLC4A1 protein, but repressed that of transcription factor PU.1. PMID: 28216155
  22. Moreover, the expression of a cell proliferation marker Ki67 was significantly decreased in tumors from the mice not taking doxycycline, compared with that of tumors from the mice continuously taking doxycycline. The present data strongly suggest that PU.1 functions as a tumor suppressor of myeloma cells in vivo. PMID: 28347818
  23. we demonstrated that miR-22 promoted monocyte/macrophage differentiation, and MECOM (EVI1) mRNA is a direct target of miR-22 and MECOM (EVI1) functions as a negative regulator in the differentiation.The miR-22-mediated MECOM degradation increased c-Jun but decreased GATA2 expression, which results in increased interaction between c-Jun and PU.1 PMID: 27617961
  24. we conclude that PU.1 transactivates the pIII through direct binding to Ets-motifs in the promoter in pDCs PMID: 27105023
  25. Our results suggest the existence of a Vav1/PU.1/miR-142-3p network that supports all-trans retinoic acid -induced differentiation in acute promyelocytic leukemia -derived cells PMID: 27480083
  26. Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages. PMID: 26942192
  27. This study showed that HCV infection might abrogate NK cytotoxic potential through altering PU.1, NKG2D receptor and perforin molecules. PMID: 26429314
  28. SPI1-GFI1B transcriptional network is an important regulatory axis in acute myeloid leukemia as well as in the development of erythroid versus myelomonocytic cell fate PMID: 26851695
  29. The GATA-1-mediated inhibition of PU.1 gene transcription in human AML-erythroleukemias mediated through the URE represents important mechanism that contributes to PU.1 downregulation and leukemogenesis that is sensitive to DNA demethylation therapy PMID: 27010793
  30. PU.1 downregulation was noted in B-CLL/SLL samples positive for the adverse prognostic markers CD38 and ZAP-70. PMID: 26261072
  31. PU.1 recruitment coupled with increased histone acetylation induces gene expression and activates a monocyte/macrophage transcriptional programme. PMID: 26126967
  32. This study demonstrated positive regulation of monocyte/macrophage differentiation by lnc-MC and uncovered an elaborate regulation mechanism composed of PU.1, lnc-MC, miR-199a-5p, and ACVR1B. PMID: 26149389
  33. Collectively, IMiDs exert demethylation activity through inhibiting DNMT1, 3a, and 3b, and up-regulating PU.1 expression, which may be one of the mechanisms of the anti-myeloma activity of IMiDs. PMID: 26657848
  34. Loss of PU.1 expression is associated with Hepatocellular Carcinoma. PMID: 25987019
  35. PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation. PMID: 25072246
  36. This review summarizes current knowledge and ideas of molecular mechanisms by which PU.1 controls hematopoiesis and suppresses leukemia. [review] PMID: 25205721
  37. A novel network has been described in acute myeloid leukemia in which FLT3-ITD signaling induces oncogenic miR-155 by p65 and STAT5 thereby targeting transcription factor PU.1. PMID: 25092144
  38. The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence. PMID: 25184385
  39. Runx-dependent PU.1 chromatin interaction and transcription of PU.1 are essential for both normal and leukemia stem cells. PMID: 25185713
  40. PU.1- targeted genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation. PMID: 24028770
  41. DNA complex may be relevant to an emerging role of PU.1, but not Ets-1, as a pioneer transcription factor in vivo PMID: 24952944
  42. Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts. PMID: 24498324
  43. The PU.1-regulated MAP1S gene is implicated in neutrophil differentiation and autophagy control. PMID: 25043887
  44. hnRNP K and PU.1 act synergistically during granulocytic differentiation, hnRNP K seems to have a negative effect on PU.1 activity during monocytic maturation PMID: 25005557
  45. Data indicate that transcription factors RUNX1 and PU.1 cooperated to exchange corepressors for coactivators, and deficiency of RUNX1, frequent in leukemia, caused aberrant recruitment of specific corepressors instead of coactivators to PU.1. PMID: 24695740
  46. IL-32theta; reduces PKCdelta-mediated phosphorylation of PU.1, resulting in attenuation of IL-1beta production PMID: 24996056
  47. HSF1 appears as a fine-tuning regulator of SPI1/PU.1 expression at the transcriptional and post-translational levels during macrophage differentiation of monocytes. PMID: 24504023
  48. our findings demonstrate that PU.1 contributes to the development of MLL leukemia, partially via crosstalk with the MEIS/HOX pathway. PMID: 24445817
  49. Given the importance of C/EBPs and PU.1 in myeloid development, these results, thus, suggest that restoration of the normal function of the myeloid cell transcriptional machinery is a major molecular mechanism underlying the differentiation induction PMID: 24379003
  50. Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis PMID: 24908389
  51. PML/RARalpha suppresses PU.1-dependent activation of the proteasome immunosubunits in acute promyelocytic leukemia. PMID: 23770850
  52. we have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay. PMID: 24639354
  53. the expression control of Tal2 in hematopoietic cells PMID: 24086757
  54. The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL. PMID: 24038216
  55. These results show that PU.1 controls human microglial viability and function and suggest PU.1 as a molecular target for manipulation of human microglial phenotype. PMID: 23483680
  56. TLR2 down-regulates FcepsilonRI and its transcription factor PU.1 in human Langerhans cells. PMID: 23534406
  57. PU.1 and CEBPA are direct transcriptional regulators of CORO1A in acute promyelocytic leukemia and acute myeloid leukemia. PMID: 23252456
  58. MT-1A is epigenetically regulated by PU.1 during monocytic differentiation. PMID: 23501100
  59. PU.1 mediates chromosome looping and functions as a master regulator of HSC proliferation. PMID: 23395001
  60. PU.1 sites may have served as anchor loci for the formation of new and functionally relevant PPARG binding sites throughout evolution. PMID: 23118933
  61. Data suggest that PU.1 is a potent tumor suppressor in classical Hodgkin lymphoma (cHL) and that induction of PU.1 with demethylation agents and/or histone deacetylase inhibitors is a possible therapeutic option for patients with cHL. PMID: 23212521
  62. Epigenetic modification of PU.1 in chronic myeloid leukemia patients and K562 cell line might be responsible for the reduced expression of PU.1. PMID: 22780968
  63. A SNP in the 3'-untranslated region of SPI1 is associated with elevated SPI1 mRNA level and with susceptibility to systemic lupus erythematosus. PMID: 21360505
  64. PU.1 positively regulates the ST2 promoter as a transcription factor that directly transactivates the ST2 promoter via Ets-family-related cis-element in mast cells and basophils. PMID: 22824976
  65. results thus shed light on how PU.1 and Ikaros can act as lineage competency factors to facilitate both myeloid and lymphoid developmental programs PMID: 22231443
  66. Low PU.1 expression in acute promyelocytic leukemia patients is required for disease initiation and progression. PMID: 22569057
  67. These data suggest that aberrant methylation of PU.1 may play a role in CML pathogenesis, and may therefore serve as a useful biomarker and potential target for demethylating drugs. PMID: 22674382
  68. HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells. PMID: 22498738
  69. Age- and differentiation-status-related epigenetic modifications of PU.1 is a unique regulator of Th9 memory acquisition and Th9 immunity. PMID: 22446486
  70. Two signals are required for the self-renewal of Friend virus leukemia stem cells, proviral insertional activation of Spi1 and Hedgehog-dependent signaling. PMID: 22083997
  71. Transcriptional regulation of MIR29B by PU.1 (SPI1) and MYC during neutrophil differentiation of acute promyelocytic leukaemia cells. PMID: 22145969
  72. the down-regulation of PU.1 expression suppresses the expression of SIRPalpha1. PMID: 22075620
  73. Data show that IRF8 binds a large number of genes by targeting two distinct motifs, half of which are also targeted by PU.1. PMID: 22096565
  74. Studies identified a physical and functional interaction between RUNX1 (AML1) and MLL and show that both are required to maintain the histone lysine 4 trimethyl mark (H3K4me3) at 2 critical regulatory regions of the AML1 target gene PU.1. PMID: 22012064
  75. Upon macrophage differentiation PU.1 represses the miR-17-92 cluster promoter by an Egr-2/Jarid1b-mediated H3K4 demethylation mechanism whose deregulation may contribute to leukaemic states. PMID: 21897363
  76. PKCdelta regulated PU.1 activity by affecting its transactivation activity, whereas its DNA binding activity remained unaffected PMID: 21732487
  77. PU.1 expression levels were increased in the monocytes of major depressive disorder patients, but not in those of schizophrenic or bipolar patients. PU.1 bound to both the TREM-1 & DAP12 promoters. PMID: 21421043
  78. Expression of PU.1 downstream of activated JAK2 may explain why JAK2 mutations are frequently observed in myeloproliferative neoplasms patients. PMID: 21789226
  79. IFN-gamma induces expression of PU.1 in human erythroid precursors. PMID: 21725055
  80. RUNX1 deficiency is associated with persistent corepressor interaction with PU.1. PMID: 21518930
  81. regulation of adult hematopoiesis through TIF1gamma-mediated transcriptional repression of TAL1 and PU.1 target genes. PMID: 21474105
  82. Data show that two transcription factors, PU.1 and C/EBPalpha, appear to synergistically mediate enhancer creation and affect NF-kappaB target selection in THP-1 cells. PMID: 21402921
  83. PU.1 is a major transcriptional activator of LIMD1 PMID: 21402070
  84. PU.1 regulates its expression in B cells and macrophages by differentially associating with cell type-specific transcription factors at one of its cis-regulatory elements PMID: 21239694
  85. Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation. PMID: 21216962
  86. ATRA up-regulates the expression of PU.1; and PU.1 preferentially binds to one of the two putative binding sites on the RIG-G promoter PMID: 21176776
  87. increased NF-kappaB activity leads to increased miR-155, which results in decreased PU.1, and consequently reduced CD10 mRNA and protein. PMID: 20947507
  88. CLEC5A expression in monocyte/macrophage and granulocytes is regulated by PU.1. PMID: 21094529
  89. ZNF300 was activated by PU.1 and suggested that the regulation may be involved in the progression of leukemia development and hematopoietic differentiation. PMID: 20471086
  90. Spi-1 increases the speed of replication by acting specifically on elongation rather than enhancing origin firing. PMID: 20660370
  91. This review focuses on important protein-protein interactions of PU.1 that play a crucial role in regulation of normal as well as malignant haematopoiesis. PMID: 19382896
  92. Here, we identified nuclear factor-kappaB (NF-kappaB) to activate PU.1 expression through a novel site within the upstream enhancer element. PMID: 19966852
  93. Collectively, we show that either activation of PU.1 or inhibition of GATA-1 efficiently reverses the transcriptional block imposed by GATA-1 and leads to the activation of a myeloid transcriptional program directed by PU.1. PMID: 19825991
  94. ATRA-induced increase of Vav1 expression and phosphorylation may be involved in recruiting PU.1 to the CD11b promoter and in regulating CD11b expression during the late stages of neutrophil differentiation of APL-derived promyelocytes. PMID: 19747912
  95. PU.1 trans activation of gp91(phox) promoter PMID: 11926990
  96. Loss of PU.1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease. PMID: 11929801
  97. Multiple PU.1 sites cooperate in the regulation of p40(phox) transcription during granulocytic differentiation of myeloid cells. PMID: 12036891
  98. C/EBPalpha and PU.1 interact physically and colocalize in myeloid cells, and C/EBPalpha blocks the function of PU.1. PMID: 12091339
  99. Heterozygous PU.1 mutations are associated with acute myeloid leukemia, causing disruption of PU.1 function, contributing to the block in cell differentiation found in AML patients. PMID: 12130514
  100. Distinct functions for STAT1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter. PMID: 12130529

Show More

Hide All

Subcellular Location Nucleus
Protein Families ETS family
Database Links

HGNC: 11241

OMIM: 165170

KEGG: hsa:6688

STRING: 9606.ENSP00000227163

UniGene: Hs.502511

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1