Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Elongin binding protein; G7 protein; HRCA 1; HRCA1; Protein G7; pVHL; RCA 1; RCA1; VHL 1; VHL; VHL_HUMAN; VHL1; VHLH; Von Hippel Lindau; Von Hippel Lindau disease tumor suppressor; von Hippel Lindau syndrome; von Hippel Lindau tumor suppressor; Von Hippel Lindau tumor suppressor, E3 ubiquitin protein ligase; Von Hippel-Lindau disease tumor suppressor
Species
Homo sapiens (Human)
Expression Region
1-213aa
Target Protein Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human VHL was expressed with the amino acid range of 1-213. This VHL protein is theoretically predicted to have a molecular weight of 28.2 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis tag was smoothly integrated into the coding gene of VHL, which enables a simple process of detecting and purifying the VHL recombinant protein in the following steps.
The human Von Hippel-Lindau disease tumor suppressor (VHL) is a critical protein that plays a key role in the regulation of cellular responses to oxygen levels. It functions as a tumor suppressor by targeting specific proteins for degradation, particularly under conditions of normoxia (normal oxygen levels). VHL is best known for its role in the ubiquitin-proteasome pathway, where it serves as the substrate recognition component of an E3 ubiquitin ligase complex. In normoxic conditions, VHL binds to hypoxia-inducible factor (HIF), marking it for ubiquitination and subsequent degradation. HIF is a transcription factor that, under low oxygen levels (hypoxia), would typically induce the expression of genes involved in angiogenesis and glycolysis. Therefore, VHL indirectly regulates the cellular response to hypoxia by preventing the accumulation of HIF. Mutations in the VHL gene are associated with Von Hippel-Lindau disease, a hereditary cancer syndrome characterized by the development of tumors in various organs. Research on VHL often explores its intricate involvement in cellular oxygen sensing, angiogenesis, and tumor suppression.
