Recombinant Human Von Hippel-Lindau disease tumor suppressor(VHL)

In Stock
Code CSB-EP025852HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P40337
Lead Time 3-7 business days
Relevance Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Research Area Cancer
Source E.coli
Gene Names VHL
Protein Names Protein G7 pVHL
Expression Region 1-213aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.2 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Involvement in disease Pheochromocytoma (PCC); von Hippel-Lindau disease (VHLD); Erythrocytosis, familial, 2 (ECYT2); Renal cell carcinoma (RCC)
Subcellular Location Isoform 1: Cytoplasm, Membrane, Peripheral membrane protein, Nucleus, Note=Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated, Colocalizes with ADRB2 at the cell membrane, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, Nucleus
Protein Families VHL family
Tissue Specificity Expressed in the adult and fetal brain and kidney.
Database Links

HGNC: 12687

OMIM: 144700

KEGG: hsa:7428

STRING: 9606.ENSP00000256474

UniGene: Hs.517792

Pathway HIF-1 signaling pathway
Ubiquitin mediated proteolysis

Related Products

VHL Antibodies

VHL Antibodies for Homo sapiens (Human)

VHL Proteins

VHL Proteins for Homo sapiens (Human)

VHL ELISA Kit

VHL ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.