CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-YP004458MO |
Size |
US$1593Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Recombinant murine Calreticulin (Calr) fragment Asp18-Leu416 with an N-terminal 6xHis-tag was expressed in yeast. This LC-MS/MS Analysis-verified Yeast-expressed Recombinant Mouse Calr peptide is the full-length mature protein from amino acid 18 to 416. It is greater than 90% in purity as determined by SDS-PAGE. Its predicted molecular weight is approximately 48.3 kDa. Under reducing conditions, its actual molecular mass is a little bit more than that of the calculated due to glycosylation. This Calr protein can immunize animals such as rabbits to generate corresponding antibodies and also be used in the studies of cancer therapies. Calr is a highly conserved endoplasmic reticulum chaperone protein involved in multiple cellular activities, such as proper protein folding and assembly, the maintenance of intracellular calcium homeostasis, cell adhesion, and RNA stability. Also, emerging evidence shows that Calr is involved in tumorigenesis by promoting proliferation, migration, and adhesion. Interestingly, Calr translocated to the cell surface facilitates the phagocytic uptake of apoptotic and cancer cells by inducing an immune response, which may suggest a potent immunotherapy-based anti-cancer strategy. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | Calr |
Uniprot No. | P14211 |
Research Area | Others |
Alternative Names | CalrCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP |
Species | Mus musculus (Mouse) |
Source | Yeast |
Expression Region | 18-416aa |
Target Protein Sequence | DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 48.3kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
![]() |
Calreticulin Blockade Attenuates Murine Acute Lung Injury by Inducing Polarization of M2 Subtype Macrophages. Z Jiang,Front Immunol,2020 Applications: extracellular CALR binding assay |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity). |
Gene References into Functions |
|
Subcellular Location | Endoplasmic reticulum lumen, Cytoplasmic granule, Sarcoplasmic reticulum lumen |
Protein Families | Calreticulin family |
Database Links |
KEGG: mmu:12317 STRING: 10090.ENSMUSP00000003912 UniGene: Mm.1971 |