Recombinant Mouse Calreticulin (Calr)

In Stock
Code CSB-EP004458MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Calr
Uniprot No.
Research Area
Others
Alternative Names
CalrCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
18-416aa
Target Protein Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
73.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Mouse Calr protein was made through genetic engineering. By putting the Calr gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired Calr protein for research uses. The expression region of this protein is at 18-416aa. N-terminal GST tag was used in the expression process. The purity is 90%+ determined by SDS-PAGE.

Calreticulin (CALR) is a Ca2+-binding endoplasmic reticulum (ER) protein that aids the folding of proteins destined to secretion and insertion in the plasma membrane, de facto providing a major contribution to the maintenance of cellular homeostasis when unfolded proteins accumulate within the ER (e.g., in the context of viral infection). Moreover, CALR mechanistically contributes to the initiation of adaptive anticancer immunity in the context of immunogenic cell death (ICD), a functional variant of regulated cell death (RCD) that is sufficient to elicit an antigen-specific immune response in immunocompetent, syngeneic hosts (provided that dying cells express antigens not covered by central or peripheral tolerance). In particular, CALR exposed on the surface of cancer cells undergoing ICD mediates robust pro-phagocytic effects, hence facilitating the uptake of dying cells or their corpses by antigen-presenting cells (APCs), in particular immature dendritic cells (DCs), which migrate to lymph nodes to cross-prime tumors specific naïve CD8+ T cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Present in the cortical granules of non-activated oocytes, is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy.
Gene References into Functions
  1. Calreticulin is required for TGF-beta mediated epithelial-mesenchymal transition and cardiomyogenesis from mESCs. PMID: 28434939
  2. CALR mutation analysis can thus be a useful additional diagnostic tool to achieve an accurate diagnosis for patients with ET who lack JAK2V617F and MPLW515 mutations PMID: 26343915
  3. CRT inhibition significantly blunted APN's anti-oxidative action (evidenced by gp91(phox) expression and superoxide generation). However, CRT inhibition did not attenuate AMPK phosphorylation by APN administration in NCM. Therefore, these novel findings strongly indicate that APN exerts cardioprotective effects against I/R injury partially via CRT mediated anti-apoptotic and anti-oxidative actions. PMID: 27757734
  4. we show that the homologous mouse CALR del52, ins5 and del61 mutants also activate thrombopoietin receptor signaling via JAK-STAT pathway PMID: 26987905
  5. study provides a model showing that the C-terminal of mutant CALR activated JAK-STAT signaling specifically downstream of MPL and may have a central role in CALR-induced myeloproliferative neoplasms PMID: 27807369
  6. the results of this investigation provide the first molecular insights into the phospholipid binding site of calreticulin as a key anchor point for the cell surface expression of calreticulin on apoptotic cells PMID: 27036911
  7. a profound impairment in calreticulin function when its lectin site was inactivated. Remarkably, inactivation of the polypeptide binding site had little impact. These findings indicate that the lectin-based mode of client interaction is the predominant contributor to the chaperone functions of calreticulin within the endoplasmic reticulum. PMID: 27413183
  8. This essential role of calreticulin in nucleocytoplasmic communication competency ties its regulatory action with proficiency of cardiac myofibrillogenesis essential for proper cardiac development. PMID: 26826378
  9. Study provides evidence that chronic stress activates calreticulin and might be one of the pathological mechanisms underlying the motor coordination and motor learning dysfunctions seen in social defeat mice. PMID: 26815100
  10. This study for the first time revealed that increased CRT inhibited Fas/FasL-mediated neuronal cell apoptosis during the early stage of ischemic stroke, suggesting it to be a potential protector activated soon after ischemia-reperfusion injury PMID: 26583143
  11. The findings highlight the importance of CALR in female reproduction and demonstrate that compromised CALR function leads to ovarian insufficiency and female infertility. PMID: 26388295
  12. Calreticulin mediates vascular smooth muscle cell responses to injury through the regulation of collagen deposition and neointima formation. PMID: 26910059
  13. CALR mutants are sufficient to induce thrombocytosis through MPL activation. PMID: 26608331
  14. Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants. PMID: 26668133
  15. These studies reveal central roles for ATP and calcium binding as regulators of calreticulin-substrate interactions and as key determinants of PLC dynamics. PMID: 26420867
  16. study demonstrates for the first time that LRH-1 has a CRT-dependent NES which is not only required for cytoplasmic trafficking, but also essential for correct protein folding to avoid misfolding-induced aggregation. PMID: 26268559
  17. Arginylated CRT has a longer half-life than non-arginylated CRT and displays different ubiquitin dependence. PMID: 25969538
  18. Data suggest that oligomerization of calreticulin (CRT) may occur under certain pathophysiological conditions (42 degrees C/pH 6.5) and the resultant oligomers may exhibit exaggerated immunostimulating activities. PMID: 25171171
  19. In calreticulin-deficient embryonic stem (ES) cells WNT and miR-302 dependent maintenance of the naive ES cell state and the transition to primed pluripotency are lost. PMID: 24415131
  20. Calreticulin expression was also found to have a dramatic effect on the phosphorylation state of serine 636 of IRS-1, such that phosphorylation of IRS-1 on serine 636 increased radically in the absence of calreticulin. PMID: 24470116
  21. CRT is critically involved in the molecular mechanisms that drive renal fibrosis progression. PMID: 24035512
  22. The recruitment of monoglucosylated proteins to calreticulin is kinetically driven, whereas the P-domain and co-chaperone contribute to stable substrate binding. PMID: 24100026
  23. CRT-regulated Ca(2+)-dependent pathways are a critical molecular link between ER stress and TGF-beta fibrotic signaling PMID: 23564462
  24. The experimental autommune encephalomyelitis-modulating effect of recombinant CRT/39-272 is attributed to activation/expansion of CD1d(hi)CD5+ IL-10-secreting B cells rather than induction of CRT-specific antibodies PMID: 23523122
  25. data revealed a novel regulatory role for Bruton's tyrosine kinase in mediating apoptotic cell clearance, with calreticulin identified as the critical component of the CRT/CD91/C1q system targeted by Btk PMID: 23596312
  26. Citrullinated CRT is overabundant in the rheumatoid arthritis synovium and potentiates shared epitope-activated signaling in vitro. PMID: 23233327
  27. roles for calreticulin in cross-presentation of ovalbumin PMID: 22848581
  28. Calreticulin appears on the surface of murine T cells soon after activation and remains detectable (at relatively low level) by flow cytometry for approximately 5 days in vitro. PMID: 22685035
  29. post-translational arginylation of CRT can regulate its intracellular localization, cell function, and survival PMID: 22577148
  30. ATF6-mediated down-regulation of miR-455 augments calreticulin expression, which may contribute to the protective effects of ATF6 in the heart. PMID: 22326432
  31. enolase 1 and calreticulin are important proteins in regulating the differentiation and functions of bone marrow mast cells PMID: 21803152
  32. Calreticulin chaperones regulate functional expression of vomeronasal type 2 pheromone receptors. PMID: 21933956
  33. the expression of calreticulin and high-mobility group box-1 protein following Photofrin-photodynamic therapy (PDT) of Lewis lung carcinoma cells uncovers important mechanistic insights into the development of host response induced by PDT PMID: 21644033
  34. Surface expression of CRT in viable, thapsigargin-treated fibroblasts correlates with their enhanced phagocytic uptake by bone marrow-derived dendritic cells. PMID: 21670312
  35. Calreticulin is a thermostable protein with distinct structural responses to different divalent cation environments. PMID: 21177861
  36. The polypeptide binding conformation of calreticulin facilitates its cell-surface expression under conditions of endoplasmic reticulum stress PMID: 21075854
  37. Calreticulin controls the rate of assembly of CD1d molecules in the endoplasmic reticulum. PMID: 20861015
  38. Structural basis of carbohydrate recognition by calreticulin. PMID: 20880849
  39. magnetic resonance imaging and histopathology detected a ventricular septal defect, revealing organogenic manifestation of calreticulin deletion. PMID: 20506533
  40. We argue that calreticulin is a potent stimulatory molecule to B cells and macrophages via the TLR-4/CD14 pathway and plays important roles in the pathogenesis of autoimmune diseases. PMID: 20855873
  41. Study demonstrated involvement of residues Glu(217) and Glu(223)--and to a lesser extent residue Asp(220)--in binding with rheumatoid arthritis shared epitope. PMID: 20661469
  42. Calreticulin and glycoprotein 96 chaperone the majority of antigenic peptides in the endoplasmic reticulum before exiting in association with class I histocompatibility antigen heavy chains and beta 2-microglobulin as a trimolecular complex. PMID: 20410492
  43. Post-translational arginylation of retrotranslocated CRT, together with the decrease in intracellular calcium ions, promotes the association of CRT to stress granules. PMID: 20423325
  44. calreticulin may have a protective effect on the heart in the face of cardiac hypertrophy. PMID: 20110410
  45. Data show that interactions with the thiol oxidoreductase ERp57 and substrate glycans are important for the recruitment of calreticulin into the peptide loading complex and for its functional activities in MHC class I assembly. PMID: 19959473
  46. These data identify calreticulin (CRT) as an important regulator of collagen and suggest that intracellular CRT signaling plays an important role in tissue remodeling and fibrosis. PMID: 20044481
  47. Calreticulin reveals a critical Ca(2+) checkpoint in cardiac myofibrillogenesis PMID: 12105184
  48. Removal of Ca2+ from calreticulin inhibits its capacity to stimulate the nuclear export of GR and the inhibition is due to the failure of Ca2+-free calreticulin to bind the DNA-binding domain of the GR. PMID: 12167720
  49. calreticulin and calcineurin play fundamental roles in Ca(2+)-dependent pathways essential for normal cardiac development and explain the molecular basis for the rescue of calreticulin-deficient phenotype PMID: 12377773
  50. Data show that in calreticulin-deficient cells, calnexin-substrate association is severely reduced, leading to accumulation of unfolded proteins and a triggering of the unfolded protein response. PMID: 12727205

Show More

Hide All

Subcellular Location
Endoplasmic reticulum lumen. Cytoplasm, cytosol. Cytolytic granule. Secreted, extracellular space, extracellular matrix. Cell surface. Sarcoplasmic reticulum lumen. Cytoplasmic vesicle, secretory vesicle, Cortical granule.
Protein Families
Calreticulin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*