Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CalrCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
Species
Mus musculus (Mouse)
Expression Region
18-416aa
Target Protein Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Mouse Calr protein was made through genetic engineering. By putting the Calr gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired Calr protein for research uses. The expression region of this protein is at 18-416aa. N-terminal GST tag was used in the expression process. The purity is 90%+ determined by SDS-PAGE.
Calreticulin (CALR) is a Ca2+-binding endoplasmic reticulum (ER) protein that aids the folding of proteins destined to secretion and insertion in the plasma membrane, de facto providing a major contribution to the maintenance of cellular homeostasis when unfolded proteins accumulate within the ER (e.g., in the context of viral infection). Moreover, CALR mechanistically contributes to the initiation of adaptive anticancer immunity in the context of immunogenic cell death (ICD), a functional variant of regulated cell death (RCD) that is sufficient to elicit an antigen-specific immune response in immunocompetent, syngeneic hosts (provided that dying cells express antigens not covered by central or peripheral tolerance). In particular, CALR exposed on the surface of cancer cells undergoing ICD mediates robust pro-phagocytic effects, hence facilitating the uptake of dying cells or their corpses by antigen-presenting cells (APCs), in particular immature dendritic cells (DCs), which migrate to lymph nodes to cross-prime tumors specific naïve CD8+ T cells.