Code | CSB-EP004458MO |
Size | US$2466 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Recombinant Mouse Calr protein was made through genetic engineering. By putting the Calr gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired Calr protein for research uses. The expression region of this protein is at 18-416aa. N-terminal GST tag was used in the expression process. The purity is 90%+ determined by SDS-PAGE. Calreticulin (CALR) is a Ca2+-binding endoplasmic reticulum (ER) protein that aids the folding of proteins destined to secretion and insertion in the plasma membrane, de facto providing a major contribution to the maintenance of cellular homeostasis when unfolded proteins accumulate within the ER (e.g., in the context of viral infection). Moreover, CALR mechanistically contributes to the initiation of adaptive anticancer immunity in the context of immunogenic cell death (ICD), a functional variant of regulated cell death (RCD) that is sufficient to elicit an antigen-specific immune response in immunocompetent, syngeneic hosts (provided that dying cells express antigens not covered by central or peripheral tolerance). In particular, CALR exposed on the surface of cancer cells undergoing ICD mediates robust pro-phagocytic effects, hence facilitating the uptake of dying cells or their corpses by antigen-presenting cells (APCs), in particular immature dendritic cells (DCs), which migrate to lymph nodes to cross-prime tumors specific naïve CD8+ T cells. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | Calr |
Uniprot No. | P14211 |
Research Area | Others |
Alternative Names |
CalrCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
|
Species | Mus musculus (Mouse) |
Source | E.coli |
Expression Region | 18-416aa |
Target Protein Sequence | DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 73.3kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Present in the cortical granules of non-activated oocytes, is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy.
|
Gene References into Functions |
|
Subcellular Location | Endoplasmic reticulum lumen. Cytoplasm, cytosol. Cytolytic granule. Secreted, extracellular space, extracellular matrix. Cell surface. Sarcoplasmic reticulum lumen. Cytoplasmic vesicle, secretory vesicle, Cortical granule. |
Protein Families | Calreticulin family |
Database Links |
KEGG: mmu:12317 STRING: 10090.ENSMUSP00000003912 UniGene: Mm.1971 |