Recombinant Mouse Calreticulin(Calr)

Code CSB-EP004458MO
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Calr
Uniprot No. P14211
Research Area Others
Alternative Names CalrCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
Species Mus musculus (Mouse)
Source E.coli
Expression Region 18-416aa
Target Protein Sequence DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 73.3kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).
Gene References into Functions
  1. Calreticulin is required for TGF-beta mediated epithelial-mesenchymal transition and cardiomyogenesis from mESCs. PMID: 28434939
  2. CALR mutation analysis can thus be a useful additional diagnostic tool to achieve an accurate diagnosis for patients with ET who lack JAK2V617F and MPLW515 mutations PMID: 26343915
  3. CRT inhibition significantly blunted APN's anti-oxidative action (evidenced by gp91(phox) expression and superoxide generation). However, CRT inhibition did not attenuate AMPK phosphorylation by APN administration in NCM. Therefore, these novel findings strongly indicate that APN exerts cardioprotective effects against I/R injury partially via CRT mediated anti-apoptotic and anti-oxidative actions. PMID: 27757734
  4. we show that the homologous mouse CALR del52, ins5 and del61 mutants also activate thrombopoietin receptor signaling via JAK-STAT pathway PMID: 26987905
  5. study provides a model showing that the C-terminal of mutant CALR activated JAK-STAT signaling specifically downstream of MPL and may have a central role in CALR-induced myeloproliferative neoplasms PMID: 27807369
  6. the results of this investigation provide the first molecular insights into the phospholipid binding site of calreticulin as a key anchor point for the cell surface expression of calreticulin on apoptotic cells PMID: 27036911
  7. a profound impairment in calreticulin function when its lectin site was inactivated. Remarkably, inactivation of the polypeptide binding site had little impact. These findings indicate that the lectin-based mode of client interaction is the predominant contributor to the chaperone functions of calreticulin within the endoplasmic reticulum. PMID: 27413183
  8. This essential role of calreticulin in nucleocytoplasmic communication competency ties its regulatory action with proficiency of cardiac myofibrillogenesis essential for proper cardiac development. PMID: 26826378
  9. Study provides evidence that chronic stress activates calreticulin and might be one of the pathological mechanisms underlying the motor coordination and motor learning dysfunctions seen in social defeat mice. PMID: 26815100
  10. This study for the first time revealed that increased CRT inhibited Fas/FasL-mediated neuronal cell apoptosis during the early stage of ischemic stroke, suggesting it to be a potential protector activated soon after ischemia-reperfusion injury PMID: 26583143
  11. The findings highlight the importance of CALR in female reproduction and demonstrate that compromised CALR function leads to ovarian insufficiency and female infertility. PMID: 26388295
  12. Calreticulin mediates vascular smooth muscle cell responses to injury through the regulation of collagen deposition and neointima formation. PMID: 26910059
  13. CALR mutants are sufficient to induce thrombocytosis through MPL activation. PMID: 26608331
  14. Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants. PMID: 26668133
  15. These studies reveal central roles for ATP and calcium binding as regulators of calreticulin-substrate interactions and as key determinants of PLC dynamics. PMID: 26420867
  16. study demonstrates for the first time that LRH-1 has a CRT-dependent NES which is not only required for cytoplasmic trafficking, but also essential for correct protein folding to avoid misfolding-induced aggregation. PMID: 26268559
  17. Arginylated CRT has a longer half-life than non-arginylated CRT and displays different ubiquitin dependence. PMID: 25969538
  18. Data suggest that oligomerization of calreticulin (CRT) may occur under certain pathophysiological conditions (42 degrees C/pH 6.5) and the resultant oligomers may exhibit exaggerated immunostimulating activities. PMID: 25171171
  19. In calreticulin-deficient embryonic stem (ES) cells WNT and miR-302 dependent maintenance of the naive ES cell state and the transition to primed pluripotency are lost. PMID: 24415131
  20. Calreticulin expression was also found to have a dramatic effect on the phosphorylation state of serine 636 of IRS-1, such that phosphorylation of IRS-1 on serine 636 increased radically in the absence of calreticulin. PMID: 24470116
  21. CRT is critically involved in the molecular mechanisms that drive renal fibrosis progression. PMID: 24035512
  22. The recruitment of monoglucosylated proteins to calreticulin is kinetically driven, whereas the P-domain and co-chaperone contribute to stable substrate binding. PMID: 24100026
  23. CRT-regulated Ca(2+)-dependent pathways are a critical molecular link between ER stress and TGF-beta fibrotic signaling PMID: 23564462
  24. The experimental autommune encephalomyelitis-modulating effect of recombinant CRT/39-272 is attributed to activation/expansion of CD1d(hi)CD5+ IL-10-secreting B cells rather than induction of CRT-specific antibodies PMID: 23523122
  25. data revealed a novel regulatory role for Bruton's tyrosine kinase in mediating apoptotic cell clearance, with calreticulin identified as the critical component of the CRT/CD91/C1q system targeted by Btk PMID: 23596312
  26. Citrullinated CRT is overabundant in the rheumatoid arthritis synovium and potentiates shared epitope-activated signaling in vitro. PMID: 23233327
  27. roles for calreticulin in cross-presentation of ovalbumin PMID: 22848581
  28. Calreticulin appears on the surface of murine T cells soon after activation and remains detectable (at relatively low level) by flow cytometry for approximately 5 days in vitro. PMID: 22685035
  29. post-translational arginylation of CRT can regulate its intracellular localization, cell function, and survival PMID: 22577148
  30. ATF6-mediated down-regulation of miR-455 augments calreticulin expression, which may contribute to the protective effects of ATF6 in the heart. PMID: 22326432
  31. enolase 1 and calreticulin are important proteins in regulating the differentiation and functions of bone marrow mast cells PMID: 21803152
  32. Calreticulin chaperones regulate functional expression of vomeronasal type 2 pheromone receptors. PMID: 21933956
  33. the expression of calreticulin and high-mobility group box-1 protein following Photofrin-photodynamic therapy (PDT) of Lewis lung carcinoma cells uncovers important mechanistic insights into the development of host response induced by PDT PMID: 21644033
  34. Surface expression of CRT in viable, thapsigargin-treated fibroblasts correlates with their enhanced phagocytic uptake by bone marrow-derived dendritic cells. PMID: 21670312
  35. Calreticulin is a thermostable protein with distinct structural responses to different divalent cation environments. PMID: 21177861
  36. The polypeptide binding conformation of calreticulin facilitates its cell-surface expression under conditions of endoplasmic reticulum stress PMID: 21075854
  37. Calreticulin controls the rate of assembly of CD1d molecules in the endoplasmic reticulum. PMID: 20861015
  38. Structural basis of carbohydrate recognition by calreticulin. PMID: 20880849
  39. magnetic resonance imaging and histopathology detected a ventricular septal defect, revealing organogenic manifestation of calreticulin deletion. PMID: 20506533
  40. We argue that calreticulin is a potent stimulatory molecule to B cells and macrophages via the TLR-4/CD14 pathway and plays important roles in the pathogenesis of autoimmune diseases. PMID: 20855873
  41. Study demonstrated involvement of residues Glu(217) and Glu(223)--and to a lesser extent residue Asp(220)--in binding with rheumatoid arthritis shared epitope. PMID: 20661469
  42. Calreticulin and glycoprotein 96 chaperone the majority of antigenic peptides in the endoplasmic reticulum before exiting in association with class I histocompatibility antigen heavy chains and beta 2-microglobulin as a trimolecular complex. PMID: 20410492
  43. Post-translational arginylation of retrotranslocated CRT, together with the decrease in intracellular calcium ions, promotes the association of CRT to stress granules. PMID: 20423325
  44. calreticulin may have a protective effect on the heart in the face of cardiac hypertrophy. PMID: 20110410
  45. Data show that interactions with the thiol oxidoreductase ERp57 and substrate glycans are important for the recruitment of calreticulin into the peptide loading complex and for its functional activities in MHC class I assembly. PMID: 19959473
  46. These data identify calreticulin (CRT) as an important regulator of collagen and suggest that intracellular CRT signaling plays an important role in tissue remodeling and fibrosis. PMID: 20044481
  47. Calreticulin reveals a critical Ca(2+) checkpoint in cardiac myofibrillogenesis PMID: 12105184
  48. Removal of Ca2+ from calreticulin inhibits its capacity to stimulate the nuclear export of GR and the inhibition is due to the failure of Ca2+-free calreticulin to bind the DNA-binding domain of the GR. PMID: 12167720
  49. calreticulin and calcineurin play fundamental roles in Ca(2+)-dependent pathways essential for normal cardiac development and explain the molecular basis for the rescue of calreticulin-deficient phenotype PMID: 12377773
  50. Data show that in calreticulin-deficient cells, calnexin-substrate association is severely reduced, leading to accumulation of unfolded proteins and a triggering of the unfolded protein response. PMID: 12727205
  51. mutation of a single amino acid residue in calreticulin has devastating consequences for its chaperone function, indicating that mutations in chaperones may play a significant role in protein folding disorders PMID: 14522955
  52. Data show that surfactant proteins-A and -D bind SIRPalpha through globular heads to block proinflammatory mediator production, while binding to their collagenous tails stimulates proinflammatory mediator production through binding to calreticulin. PMID: 14531999
  53. calreticulin regulates p53 function by affecting its rate of degradation and nuclear localization PMID: 14767071
  54. Data demonstrate that calreticulin functionally interacts with the egg cytoskeleton and can mediate transmembrane signaling linked to cell cycle resumption. PMID: 15136153
  55. SREC-I is a type F scavenger receptor and an endocytic receptor for calreticulin PMID: 15371419
  56. Data show that oculocutaneous albinism soluble tyrosinase is an endoplasmic reticulum-associated degradation substrate that, unlike other albino tyrosinases, associates with calreticulin and BiP/GRP78, but not calnexin. PMID: 15677452
  57. calreticulin is dispensable for the cytolytic activity of granzymes and perforin, but it is required for efficient CTL-target cell interaction PMID: 15749851
  58. overexpression of CRT enhances the inactivation and degradation of sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2 in the cells under oxidative stress PMID: 15766574
  59. The present findings provide a clear molecular explanation for the embryonic lethality observed in calreticulin-deficient mice and emphasize the importance of calreticulin in the early stages of cardiac development. PMID: 15998798
  60. the level of CRT regulates the sensitivity to apoptosis under oxidative stress due to H2O2 through a change in Ca2+ homeostasis and the regulation of the Ca2+-calpain-caspase-12 pathway in myocardiac cells PMID: 16135540
  61. The ability of CRT to retrotranslocate from the ER lumen to the cytosol explains how CRT can change compartments and modulate cell adhesion, transcription, and translation. PMID: 16199864
  62. CRT in the post-endoplasmic reticulum compartments may act as a negative regulator of the cell surface CFTR PMID: 16527813
  63. Calreticulin is temporarily expressed during heart development where it is required for proper myofibrillogenesis. PMID: 17112388
  64. Overexpression of calreticulin, while partially reverses fusiform transformed phenotype is in itself insufficient to re-establish bona fide zonulae adherens in transformed fibroblasts. PMID: 17149557
  65. adiponectin deficiency in lpr mice led to a reduction in apoptotic cell clearance, which was accompanied by exacerbated systemic inflammation PMID: 17256056
  66. Data suggest that calreticulin affects fibronectin production and, thereby, assembly, and it indirectly influences the formation and/or stability of focal contacts and fibrillar adhesions, both of which are instrumental in matrix assembly and remodelling. PMID: 17373910
  67. Study indicates the first report on the role of calreticulin in regulating MMP activity. PMID: 17412577
  68. Calreticulin is critical for normal heart function and structure PMID: 17482496
  69. differences in adhesive properties of calreticulin under- and overexpressing fibroblasts in relation to the calmodulin- and calcium/calmodulin-dependent kinase II (CaMK II)-dependent signalling pathways PMID: 17516550
  70. central role of RyR2 dysfunction in CASQ2 deficiency unifies the pathophysiologic mechanism underlying Catecholamine-induced polymorphic ventricular tachycardia due to RyR2 or calsequestrin 2 mutations PMID: 17607358
  71. Calreticulin exposure is required for the immunogenicity of gamma-irradiation and UVC light-induced apoptosis. PMID: 17657249
  72. Calreticulin, a lectin chaperone, is an essential molecule for the processing of tyrosinase in murine melanocytes PMID: 17826037
  73. a calreticulin/peptide complex required the addition of an exogenous adjuvant to elicit in vivo cytotoxic CD8(+) T cell responses PMID: 17936359
  74. These results suggest that calreticulin regulates both the c-Src and calmodulin/CaMKII pathways, enabling cells to be better spread on the substratum by allowing greater fibronectin deposition and increased focal contact formation. PMID: 18255058
  75. Calr was up-regulated in a mouse model of lung fibrosis. PMID: 18563736
  76. TRalpha may follow a cooperative export pathway in which both calreticulin and CRM1 play a role in facilitating efficient translocation of TRalpha from the nucleus to cytoplasm PMID: 18641393
  77. a novel role for TSP1 signaling through the calreticulin/LRP1 co-complex in tissue remodeling and fibrotic responses through stimulation of anoikis resistance. PMID: 18653767
  78. expression is tightly regulated during cardiogenesis PMID: 18765291
  79. Calreticulin-deficient ESCs are not only highly adipogenic but also show elevated calmodulin/CaMKII signaling and poor adhesiveness compared with the wild-type ESCs. PMID: 19544411
  80. Data propose here that calreticulin, an ER Ca(2+) storage protein, is a crucial regulator of cardiomyogenesis whose presence is required for controlled cardiomyocyte development from ES cells. PMID: 19544459
  81. In the absence of CRT, ERp57 is up-regulated, which indicates that they collaborate with each other in class I antigen processing. PMID: 19748124

Show More

Hide All

Subcellular Location Endoplasmic reticulum lumen, Cytoplasmic granule, Sarcoplasmic reticulum lumen
Protein Families Calreticulin family
Database Links

KEGG: mmu:12317

STRING: 10090.ENSMUSP00000003912

UniGene: Mm.1971

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1