Recombinant Mouse Metalloproteinase inhibitor 1(Timp1)

Code CSB-EP023560MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P12032
Relevance Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates th by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 . Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.1 Publication
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Collagenase inhibitor 16C8 fibroblastErythroid-potentiating activity ;EPATPA-S1TPA-induced protein;Tissue inhibitor of metalloproteinases 1 ;TIMP-1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Research Area Others
Source E.coli
Gene Names Timp1
Protein Names Recommended name: Metalloproteinase inhibitor 1 Alternative name(s): Collagenase inhibitor 16C8 fibroblast Erythroid-potentiating activity Short name= EPA TPA-S1 TPA-induced protein Tissue inhibitor of metalloproteinases 1
Expression Region 25-205aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 36.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity). Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.
Subcellular Location Secreted
Protein Families Protease inhibitor I35 (TIMP) family
Tissue Specificity Found in fetal and adult tissues. Highest levels are found in bone. Also found in lung, ovary and uterus.
Database Links

KEGG: mmu:21857

STRING: 10090.ENSMUSP00000009530

UniGene: Mm.8245

Pathway HIF-1 signaling pathway

Related Products

Timp1 Antibodies

Timp1 Antibodies for Mus musculus (Mouse)

Timp1 Proteins

Timp1 Proteins for Mus musculus (Mouse)

Timp1 ELISA Kit

Timp1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.