Name: Recombinant Rat Fibroblast growth factor 23 (Fgf23)
Brand: CUSABIO
SKU: CSB-EP008629RA

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Fgf23

Uniprot No.

Q8VI82

Research Area

Others

Alternative Names

Fgf23Fibroblast growth factor 23; FGF-23

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

25-251aa

Target Protein Sequence

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To produce recombinant Rat Fgf23 protein, a well-established recombinant DNA technology is the key. A DNA template of Fgf23 was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Rat Fgf23 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 25-251aa of the Rat Fgf23. The purity of this recombinant is 90% determined by SDS-PAGE.

FGF23 is a protein coding gene that encodes Fibroblast growth factor 23. According to some studies, FGF23 may have the following features.
FGF23 induces left ventricular hypertrophy. Targeted ablation of Fgf23 demonstrates an important physiological role of FGF23 in phosphate and vitamin D metabolism. FGF23 is a hormone that regulates phosphate metabolism—a unique biological feature of FGF23. Klotho converts the canonical FGF receptor into a specific receptor for FGF23. The rat parathyroid gland is a target organ of FGF23. Mutations in the FGF23 gene cause autosomal dominant hypophosphatemic rickets, possibly by preventing the proteolytic cleavage of FGF23 and enhancing its biological activity. Parathyroid hormone and FGF23 target the kidneys and cause phosphateuria. FGF23 also acts on the parathyroid glands to reduce PTH expression, but in chronic kidney disease.

Target Background

Function

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Gene References into Functions

Increases in plasma erythropoietin and erythropoietin receptor activation are mechanisms implicated in the increase of plasma FGF23 in acute kidney injury. PMID: 29395333
In chronic kidney disease (CKD) rat models, FGF23 mRNA is expressed in the kidney, and the FGF23 protein is expressed at high levels in osteopontin-positive renal tubule epithelium cells likely via TGFbeta1 stimulation. FGF23 produced in the kidney might contribute to P metabolism in subjects with CKD. PMID: 29518087
High FGF23 expression is associated with cardiac hypertrophy. PMID: 28339837
The only direct contribution of the injured kidney to circulating FGF23 levels in uremia appears to be reduced renal extraction of bone-derived FGF23. PMID: 28341272
Osteoblast Fgf23 transcription is upregulated by increase in the cytosolic Ca(2+) activity. Fgf23 transcription is decreased by Orai inhibitors and Orai1 silencing. Fgf23 transcription is lowered by NFkappaB inhibitors. PMID: 26631141
EPO dependent regulation pathway of FGF23 gene expression PMID: 29073196
can directly stimulate hepatic secretion of inflammatory cytokines PMID: 27457912
dietary Mg deficiency causes a rapid increase in circulating levels of FGF23 and renal 24(OH)ase mRNA levels PMID: 27624533
phosphate directly enhances Fgf23 transcription without affecting the stability of Fgf23 messenger RNA. PMID: 25792238
Fgf23 gene transcription was abolished by the actin microfilament-disrupting agent cytochalasin B, as well as by the inhibition of actin-regulating Rac1/PAK1 signaling. PMID: 26878191
Although the molecular link between the cardiac lesion and circulating Fgf23 concentrations remains to be identified, our study has uncovered a novel heart-bone-kidney axis PMID: 25858796
In conclusion, PRL was responsible for the lactation-induced mucosal adaptations, which were associated with compensatory increase in FGF-23 expression probably to prevent calcium hyperabsorption. PMID: 26657069
Data indicate that serum fibroblast growth factor 23 (FGF-23) levels independently correlated with bone volume parameters in rats with experimentally induced chronic kidney disease (CKD). PMID: 26186634
fibroblast growth factor 23 is increased by intravenous phosphate loading in uremic rats PMID: 24625659
The polycystic kidney produces FGF23 but is resistant to its action. PMID: 24402093
FGF23 enhances phosphate-induced vascular calcification by promoting osteoblastic differentiation involving the ERK1/2 pathway in the absence of Klotho deficiency. PMID: 24088960
Ca is not a regulator of acute changes in FGF23 secretion. PMID: 24801007
data suggest that inhibition of FGFR signaling following administration of either pan-FGFR inhibitor or MEK inhibitor interferes with the FGF23 pathway, predisposing animals to hyperphosphatemia PMID: 23872713
In non-iron depleted normal and uremic rats a single high dose of either of two intravenous iron preparations, iron isomaltoside 1000, and ferric carboxymaltose, had no effect on plasma levels of iFGF23 and phosphate for up to seven days. PMID: 24373521
Mg deficiency increases serum FGF-23 levels. PMID: 23608165
a direct and an indirect effect of parathyroid hormone on FGF23 secretion, the latter through changes in calcitriol concentrations PMID: 21525854
late-onset ADHR is the product of gene-environment interactions whereby the combined presence of an Fgf23-stabilizing mutation and iron deficiency can lead to ADHR PMID: 22006328
FGF23 normalizes serum phosphate and decreases 1,25-dihydroxyvitamin D levels in early-stage chronic kidney disease. PMID: 20844473
Serum FGF23 increased in uremic rats treated with paricalcitol but not those treated with cinacalcet. PMID: 20200094
because of a downregulation of the Klotho-FGFR1c receptor complex, an increase of circulating FGF23 does not decrease parathyroid hormone levels in established chronic kidney disease. PMID: 20016468
Data indicate that cleavage at the RXXR motif abrogates FGF23 activity by removing the binding site for the binary FGFR-Klotho complex in the C-terminal region of FGF23, and by generating an endogenous inhibitor of FGF23. PMID: 19966287
a feedback loop exists among serum phosphorus, 1alpha,25(OH)(2)D(3), and FGF-23, in which the novel phosphate-regulating bone-kidney axis integrated with the parathyroid hormone-vitamin D(3) axis in regulating phosphate homeostasis PMID: 15531762
rat UMR-106 osteoblast-like cells were treated with 1,25(OH)(2)D(3) resulted in a dose- and time-dependent stimulation of FGF23 mRNA concentrations. PMID: 16020653
Mineralized tissue cells are a principal source of Fgf23. PMID: 17350357
FGF23 suppressed both parathyroid hormone (PTH) secretion and PTH gene expression PMID: 17992255
These results suggest that the N- and C-terminal domains of FGF23 are responsible for association with cognate FGF receptors and Klotho, respectively, and that these interactions are indispensable for FGF23 activity. PMID: 18442315
Results show that the elevated plasma FGF23 levels in uremic rats reflect the increased expression of FGF23 in bone. PMID: 19339809
estrogens regulate PTH indirectly, possibly through FGF23 PMID: 19628670

Hide All

Subcellular Location

Secreted.

Protein Families

Heparin-binding growth factors family

Tissue Specificity

Expressed in the parathyroid.

Database Links

KEGG: rno:170583

STRING: 10116.ENSRNOP00000026888

UniGene: Rn.154421

Code	CSB-EP008629RA
Abbreviation	Recombinant Rat Fgf23 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage