Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Code CSB-BP008629RA
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008629RA-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP008629RA
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Fgf23
Uniprot No.
Research Area
Others
Alternative Names
Fgf23Fibroblast growth factor 23; FGF-23
Species
Rattus norvegicus (Rat)
Expression Region
25-251aa
Target Protein Sequence
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Mol. Weight
27.5kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
Gene References into Functions
  1. Increases in plasma erythropoietin and erythropoietin receptor activation are mechanisms implicated in the increase of plasma FGF23 in acute kidney injury. PMID: 29395333
  2. In chronic kidney disease (CKD) rat models, FGF23 mRNA is expressed in the kidney, and the FGF23 protein is expressed at high levels in osteopontin-positive renal tubule epithelium cells likely via TGFbeta1 stimulation. FGF23 produced in the kidney might contribute to P metabolism in subjects with CKD. PMID: 29518087
  3. High FGF23 expression is associated with cardiac hypertrophy. PMID: 28339837
  4. The only direct contribution of the injured kidney to circulating FGF23 levels in uremia appears to be reduced renal extraction of bone-derived FGF23. PMID: 28341272
  5. Osteoblast Fgf23 transcription is upregulated by increase in the cytosolic Ca(2+) activity. Fgf23 transcription is decreased by Orai inhibitors and Orai1 silencing. Fgf23 transcription is lowered by NFkappaB inhibitors. PMID: 26631141
  6. EPO dependent regulation pathway of FGF23 gene expression PMID: 29073196
  7. can directly stimulate hepatic secretion of inflammatory cytokines PMID: 27457912
  8. dietary Mg deficiency causes a rapid increase in circulating levels of FGF23 and renal 24(OH)ase mRNA levels PMID: 27624533
  9. phosphate directly enhances Fgf23 transcription without affecting the stability of Fgf23 messenger RNA. PMID: 25792238
  10. Fgf23 gene transcription was abolished by the actin microfilament-disrupting agent cytochalasin B, as well as by the inhibition of actin-regulating Rac1/PAK1 signaling. PMID: 26878191
  11. Although the molecular link between the cardiac lesion and circulating Fgf23 concentrations remains to be identified, our study has uncovered a novel heart-bone-kidney axis PMID: 25858796
  12. In conclusion, PRL was responsible for the lactation-induced mucosal adaptations, which were associated with compensatory increase in FGF-23 expression probably to prevent calcium hyperabsorption. PMID: 26657069
  13. Data indicate that serum fibroblast growth factor 23 (FGF-23) levels independently correlated with bone volume parameters in rats with experimentally induced chronic kidney disease (CKD). PMID: 26186634
  14. fibroblast growth factor 23 is increased by intravenous phosphate loading in uremic rats PMID: 24625659
  15. The polycystic kidney produces FGF23 but is resistant to its action. PMID: 24402093
  16. FGF23 enhances phosphate-induced vascular calcification by promoting osteoblastic differentiation involving the ERK1/2 pathway in the absence of Klotho deficiency. PMID: 24088960
  17. Ca is not a regulator of acute changes in FGF23 secretion. PMID: 24801007
  18. data suggest that inhibition of FGFR signaling following administration of either pan-FGFR inhibitor or MEK inhibitor interferes with the FGF23 pathway, predisposing animals to hyperphosphatemia PMID: 23872713
  19. In non-iron depleted normal and uremic rats a single high dose of either of two intravenous iron preparations, iron isomaltoside 1000, and ferric carboxymaltose, had no effect on plasma levels of iFGF23 and phosphate for up to seven days. PMID: 24373521
  20. Mg deficiency increases serum FGF-23 levels. PMID: 23608165
  21. a direct and an indirect effect of parathyroid hormone on FGF23 secretion, the latter through changes in calcitriol concentrations PMID: 21525854
  22. late-onset ADHR is the product of gene-environment interactions whereby the combined presence of an Fgf23-stabilizing mutation and iron deficiency can lead to ADHR PMID: 22006328
  23. FGF23 normalizes serum phosphate and decreases 1,25-dihydroxyvitamin D levels in early-stage chronic kidney disease. PMID: 20844473
  24. Serum FGF23 increased in uremic rats treated with paricalcitol but not those treated with cinacalcet. PMID: 20200094
  25. because of a downregulation of the Klotho-FGFR1c receptor complex, an increase of circulating FGF23 does not decrease parathyroid hormone levels in established chronic kidney disease. PMID: 20016468
  26. Data indicate that cleavage at the RXXR motif abrogates FGF23 activity by removing the binding site for the binary FGFR-Klotho complex in the C-terminal region of FGF23, and by generating an endogenous inhibitor of FGF23. PMID: 19966287
  27. a feedback loop exists among serum phosphorus, 1alpha,25(OH)(2)D(3), and FGF-23, in which the novel phosphate-regulating bone-kidney axis integrated with the parathyroid hormone-vitamin D(3) axis in regulating phosphate homeostasis PMID: 15531762
  28. rat UMR-106 osteoblast-like cells were treated with 1,25(OH)(2)D(3) resulted in a dose- and time-dependent stimulation of FGF23 mRNA concentrations. PMID: 16020653
  29. Mineralized tissue cells are a principal source of Fgf23. PMID: 17350357
  30. FGF23 suppressed both parathyroid hormone (PTH) secretion and PTH gene expression PMID: 17992255
  31. These results suggest that the N- and C-terminal domains of FGF23 are responsible for association with cognate FGF receptors and Klotho, respectively, and that these interactions are indispensable for FGF23 activity. PMID: 18442315
  32. Results show that the elevated plasma FGF23 levels in uremic rats reflect the increased expression of FGF23 in bone. PMID: 19339809
  33. estrogens regulate PTH indirectly, possibly through FGF23 PMID: 19628670

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in the parathyroid.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1