Recombinant Anopheles gambiae Odorant receptor Or2(OR2)

Code CSB-CF848812BZL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8WTE6
Storage Buffer Tris-based buffer,50% glycerol
Species Anopheles gambiae (African malaria mosquito)
Sequence MLIEECPIIGVNVRVWLFWSYLRRPRLSRFLVGCIPVAVLNVFQFLKLYSSWGDMSELII NGYFTVLYFNLVLRTSFLVINRRKFETFFEGVAAEYALLEKNDDIRPVLERYTRRGRMLS ISNLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCM YIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQI IQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSISNQLAQMIMIGSYIFMILSQMFAFY WHANEVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQ KLLNVSYSYFTLLRRVYN
Source in vitro E.coli expression system
Gene Names OR2
Protein Names Recommended name: Odorant receptor Or2 Alternative name(s): AgOr2
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which plays a critical role in the anthropophilic host-seeking behavior; establishes the host preference to transmit malaria.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or30a subfamily
Tissue Specificity Expressed in male and female antennae and maxillary palps.
Database Links

KEGG: aga:AgaP_AGAP009519

Related Products

OR2 Proteins

OR2 Proteins for Anopheles gambiae (African malaria mosquito)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.