Recombinant Bovine Growth hormone receptor (GHR)

Code CSB-CF009411BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Species
Bos taurus (Bovine)
Expression Region
19-634
Target Protein Sequence
FSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVTLYLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEENKPRPLLIGGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Gene References into Functions
  1. Most heifer reproductive traits were not significantly affected by CAST and CAPN1 markers that are widely used to improve beef tenderness by selection and breeders should not be concerned with how these markers affect reproduction and other heifer traits with the possible exception of CAPN1 effects on calving date. PMID: 29448132
  2. There was no association between the genotypes of GH and IGF-IS and fertility of Holstein cows raised in semiextensive or intensive regimes, while the STAT5 ABstEII polymorphism was associated with calving-first heat interval in Holstein cows raised in the intensive system. PMID: 27865414
  3. hepatic growth hormone receptor and suppressor of cytokine signaling (SOCS)2 messenger RNA expression appeared to be promptly and sensitively regulated by increased estradiol levels before ovulation of dairy heifers PMID: 25704974
  4. Comparatively studied genetic diversity of growth hormone receptor (GHR) in Tibetan cattle and Chinese Holstein cow. PMID: 25927168
  5. This work confirms the importance of CAPN1 and CAST for tenderness in beef, provides a new effect of CAST on beef tenderness, and questions the utility of GHR as a selection marker for beef quality. PMID: 24398843
  6. the data support the high potential of the growth hormone receptor F279Y polymorphism as a marker for the improvement of milk traits in selection programs PMID: 21660490
  7. 6 of the published GHR SNPs and 7 of the novel GHR SNPs were associated with at least 1 of the traits--milk yield, fat yield, protein yield, fat percentage, protein percentage, somatic cell score, calving interval, survival and growth and size traits. PMID: 20528848
  8. Effects of GHR p.Phe279Tyr mutations on milk, fat and protein yield, as well as fat and protein percentage in the milk of 1222 Holstein cows was found to be significantly associated with protein percentage. PMID: 19781040
  9. Food deprivation-induced decrease in circulating IGF-I in steers is associated with decrease in expression of different IGF-I mRNA variants and specific decrease in expression of growth hormone receptor mRNA variants 1C3 and 1A in liver. PMID: 12888636
  10. Insulin regulates the efficiency of GH signaling in liver and adipose tissue of dairy cows by acting as a rheostat of GHR synthesis. PMID: 15113939
  11. Results show that chicken ovalbumin upstream promoter transcription factor II (COUP-TFII), hepatocyte nuclear factor 4alpha (HNF-4alpha) and HNF-4gamma regulate growth hormone receptor 1A promoter activity by binding to a common DNA element PMID: 15171724
  12. allele and genotype frequencies of microsatellite markers located in the 5'-regulatory region of the IGF1 and GHR genes in beef cattle and effects of these markers on growth and carcass traits in an intensive production system PMID: 15670132
  13. molecular evolution of GHR in the Bovidae PMID: 17044257
  14. Polymorphism in exon 10 of growth hormone receptor (GHR) was found to play a role in body weight determination in three cattle breeds. Results indicated that there were six genotypes, namely AA, BB, CC, AB, AC and BC. PMID: 17369175
  15. FSH, but not E2, stimulated the expression of IR and GHR genes during follicular development. PMID: 17507188
  16. Single base substitution in the transmembrane domain encoding region of GH receptor gene may influence the physiological properties of the receptor. PMID: 17693965
  17. The effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle are reported. PMID: 17785604
  18. single nucleotide polymorphisms in GHR significantly affected feed intake, feed conversion, and body energy traits PMID: 18650297
  19. Nine single nucleotide polymorphisms were identified. PMID: 18676722
  20. DGAT1 and growth hormone receptor alleles whichor increase in milk production were found to have an adverse effect on reproduction, while the leptin allele responsible for increase in milk production was linked to marginally increased metritis frequency. PMID: 18822099
  21. Results indicate that the effects of polymorphism in ghr genes on cattle milk or meat production traits could be at least partially mediated through their effects on the igf1 gene expression in the liver and the IGF1 level in blood. PMID: 19112400

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Highly expressed in both adult and fetal liver. Lower levels in kidney, anterior pituitary, skeletal muscle, adipose tissue and mammary gland.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1