Recombinant Human CX3C chemokine receptor 1(CX3CR1)

Code CSB-CF006236HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CX3CR1
Uniprot No. P49238
Alternative Names Beta chemokine receptor-like 1; C X3 C CKR 1; C-X3-C CKR-1; CCRL1; Chemokine C X3 C motif receptor 1; CMK BRL 1; CMK-BRL-1; CMK-BRL1; CMKBLR1; CMKDR1; CX3C chemokine receptor 1; CX3C CKR1; CX3C1_HUMAN; CX3CR1; Fractalkine receptor; G-protein coupled receptor 13; GPR13; GPRV28; V28
Species Homo sapiens (Human)
Expression Region 1-355
Target Protein Sequence MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Receptor for the CX3C chemokine fractalkine (CX3CL1); binds to CX3CL1 and mediates both its adhesive and migratory functions
Gene References into Functions
  1. Study demonstrated that CX3CL1/CX3CR1 was overexpressed in prostate cancer tissues with spinal metastasis compared with primary tumors. Overexpression of CX3CR1 increased cell proliferation, migration and invasion. Also, study observed that EGFR/Src/FAK pathway was activated by CX3CL1/CX3CR1. PMID: 30066854
  2. CX3CR1 major allele carriers V249 and T280 are significantly associated with an increased total arterial blood volume of the whole brain, especially around the bilateral precuneus, left posterior cingulate cortex, and left posterior parietal cortex. PMID: 29485193
  3. investigated the association of CX3CR1 839C/T, CX3CR1 745G/A, polymorphisms with Age-Related Macular Degeneration (AMD) risk. These associated with an increased AMD risk (CX3CR1 839C/T, additive model: aOR=2.682, 95% CI=1.119-5.709, P=0.022, recessive model: aOR=2.729, 95% CI=1.141-6.048, P=0.010; CX3CR1 745G/A, additive model: aOR=2.614, 95% CI=1.231-6.012, P=0.020, recessive model: aOR=2.340, 95% CI=1.227-5.993, P=0.011 PMID: 29565837
  4. CX3CR1 regulated chondrocyte proliferation. PMID: 29217163
  5. We detected a statistically significant association between the variant Ala55Thr in CX3CR1 with schizophrenia and autism spectrum disorder phenotypes PMID: 28763059
  6. This study shown that CX3CR1 expression in both Microglia and Astrocytes in hippocampus in affected by stroke, Alzheimer's disease, and Lewy body dementia. PMID: 28398520
  7. The US28 gene product has maintained the function of the ancestral gene and has the ability to bind and signal in response to human CX3CL1, the natural ligand for CX3CR1. PMID: 28315475
  8. Our findings demonstrate that motility, invasion, and contact-independent growth of PDAC cells all increase following CX3CL1 exposure, and that antagonism of CX3CR1 by the inhibitor JMS-17-2 reduces each of these phenotypes and correlates with a downregulation of AKT phosphorylation. PMID: 29274778
  9. in Crohn's disease patients, a missense mutation in the gene encoding CX3CR1 was identified and found to be associated with impaired antifungal responses PMID: 29326275
  10. Soluble FKN that was efficiently shed from the surface of LPS-activated ECs in response to binding of CD16(+) monocytes to ECs, diminished monocyte adhesion in down-regulating CX3CR1 expression on the surface of CD16(+) monocytes resulting in decreased TNF-secretion. PMID: 27031442
  11. CX3CR1 genetic variants were not associated with risk of atherosclerotic coronary heart disease and glucometabolic traits in European ancestry cohort. In a South Asian cohort, identified CX3CR1 SNP associated with myocardial infarction and type II diabetes mellitus. PMID: 27013693
  12. FKN and CX3CR1 expression was significantly increased in pancreatic ductal adenocarcinoma (PDAC) tissues, especially in the metastatic samples, and was highly-correlated with severity of PDAC. Ectopic expression of FKN promoted the proliferation and migration of PDAC, while knockdown of CX3CR1 reversed the function of FKN. PMID: 28986258
  13. CX3CL1 is upregulated in both human and murine tumors following VEGF signaling blockade, resulting in recruitment of CX3CR1+Ly6Clo monocytes into the tumor PMID: 28691930
  14. The fractalkine functions on the activation of the AKT/NF-kappaB/p65 signalling cascade and regulation of the antiapoptosis process in pancreatic cancer cells. PMID: 28845524
  15. High expression of CX3CR1 correlates with significantly shorter survival, specifically in post-menopausal patients with advanced and terminal stages of the disease. Taken together, this support a key regulatory role for the fractalkine axis in advanced and relapsed peritoneal metastasis in epithelial ovarian carcinoma. PMID: 27941884
  16. rs3732378 and rs3732379 susceptibility loci for developmental dysplasia of the hip PMID: 27176135
  17. V249I genotype of the fractalkine receptor showed a protector role in patients with type 2 diabetes. The T280M genotype is associated with increased carotid intima-media thickness in Mexican individuals with or without type 2 diabetes PMID: 28128806
  18. CX3CR1 genetic variation sows a possible association with hypertension, diabetes mellitus and atherosclerosis comorbidities in patients treated with hemodialysis. PMID: 27118566
  19. this study shows that the expression of CX3CR1 on tonsillar CD8-positive cells is higher in IgA nephropathy patients PMID: 28196748
  20. Low CCRL1 expression is associated with hepatocellular carcinoma. PMID: 26813566
  21. Recent works show that, in allergic diseases, there is an increased expression of fractalkine/CX3CL1 and its unique receptor CX3CR1 and that this chemokine does not act as chemoattractant. In allergic asthma, CX3CR1 expression regulates Th2 and Th1 cell survival in the inflammatory lung, while, in atopic dermatitis, it regulate Th2 and Th1 cell retention into the inflammatory site. [review] PMID: 27011244
  22. cxc3cr1 is a biomarker for Alzehein disease. PMID: 26567742
  23. CX3CR1 is expressed in the normal, cancer adjacent normal, inflammatory, and malignant fallopian epithelium. PMID: 26633537
  24. genetic polymorphism is associated with delayed allograft function in Polish kidney transplat recipients PMID: 25898802
  25. CX3CR1 T allele of rs3732379 might have a positive association with the susceptibility of age-related macular degeneration PMID: 26464724
  26. CX3CR1 is expressed differentially in human monocytes during differentiation. PMID: 25502213
  27. This meta-analysis suggested that CX3CR1 T280M and V249I polymorphisms may not be associated with an increased risk of AMD based on current published data. PMID: 26651305
  28. Data show that fractalkine receptor CX3CR1 expression is decreased in both murine and human glioblastoma (GBM) tissue. PMID: 25987130
  29. Respiratory syncytial virus G protein and host CX3CR1 interaction is important in infection and infection-induced responses of the airway epithelium. PMID: 26297201
  30. Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease PMID: 26123579
  31. Specific pro-inflammatory monocyte subpopulations positive for CD16 and the co-expressed chemokine receptor, CX3CR1, are discriminative for chronic kidney disease stage 5 on hemodialysis patients. PMID: 25830914
  32. CX3CR1 is expressed in differentiated human ciliated airway cells and co-localizes with respiratory syncytial virus on cilia in a G protein-dependent manner. PMID: 26107373
  33. CX3CL1 and CX3CR1 may contribute to the formation of coronary atherosclerotic plaque in coronary artery disease PMID: 25845619
  34. Fractalkine receptor polymorphisms may not contribute to the molecular pathogenesis of ulcerative colitis. PMID: 26042517
  35. the results from the present study support the concept of the CX3CL1-mediated activation of the progression of the multiple myeloma via CX3CR1. PMID: 25962684
  36. this is the first demonstration of the role of DNA methylation in regulating the expression of the CX3CR1 gene by CD8+ T cells and the potential biological relevance of increased expression of CX3CR1 by IL-7Ra(low) effector memory CD8+ T cells in humans. PMID: 26276874
  37. The study found a significantly lower expression of CX3CR1 on CD8+ T cells in the neovascular age-related macular degeneration group compared to the control group (p = 0.04). PMID: 25503251
  38. The high expression of CX3CR1 was associated with prolonged isolated thrombocytopenia after allogeneic hematopoietic stem cell transplantation. PMID: 26141368
  39. The progression rate of ALS symptoms and the survival time is affected in patients with one or two copies of the CX3CR1 249I allele. The CX3CR1 is the most potent ALS survival genetic factor reported to date PMID: 24806473
  40. An inverse pattern was observed in gene expression levels of fractalkine receptor (CX3CR1) might be a compensatory mechanism. PMID: 24930044
  41. Findings suggest that overexpression of CX3CR1 promotes gastric cancer metastasis, proliferation and survival and, might play a physiological role in normal gastric tissue renewal and/or tissue remodeling after injury. PMID: 25482732
  42. Fractalkine and CX3CR1 may play a role in the pathogenesis of pSS, including extraglandular manifestations. PMID: 25320221
  43. Cx3cr1-deficient mononuclear phagocytes express increased P2X7 receptors, which stimulates IL-1Beta secretion. PMID: 25948251
  44. A higher percentage of circulating CD4(+) T-cells expressed CX3CR1 in relapsing-remitting multiple sclerosis compared to healthy controls. PMID: 25596452
  45. Data show that chemokine domain of fractalkine (FKN-CD) can activate alphavbeta3 integrin in the absence of fractalkine receptor CX3CR1, but that this activation requires the direct binding of FKN-CD to alphavbeta3. PMID: 24789099
  46. These findings suggest that CCR2, CX3CR1, RANTES and SDF1 gene variants seem to play an important role in the dynamics of HIV infection and could be used as drug or vaccine targets. PMID: 25313609
  47. Insulin resistance increases plaque vulnerability by augmenting the CX3CL1/CX3CR1 axis, which is mechanistically linked to reduced vascular smooth muscle cell survival PMID: 24788416
  48. our results confirm previous findings on the predominance of R5 tropism among HIV-1 treatment-naive subjects and reveal an association between a higher frequency of R5 tropism and the CX3CR1 A allele and a lower additive genetic score. PMID: 24750723
  49. CX3CR1 (T280M and V249I) and PLEKHA1 (A320T) polymorphisms were not found to be associated with age-related macular degeneration in an Indian population. PMID: 25050486
  50. Suggest that CCRL1 impairs chemotactic events associated with CCR7 in the progression and metastasis of hepatocellular carcinoma. PMID: 25255875
  51. CX3CR1 is dispensable for control of mucosal Candida albicans infections in mice and humans. PMID: 25547797
  52. Taken together, these results demonstrate that HIV-1 Tat protein suppresses CX3CR1 expression in microglia via NF-kappaB-YY1 pathway and attenuates CX3CL1-induced functional response of microglia. PMID: 24862326
  53. CX3CR1 T280M and V249I polymorphisms are associated with the susceptibility to atherosclerosis. PMID: 25221380
  54. These findings strongly suggest the implication of the CX3CL1/CX3CR1 axis in the pathogenesis of aGVHD. PMID: 25420917
  55. Study suggests that fractalkine gene receptor c.839C>T (T280M) single nucleotide polymorphism could be associated with a reduced risk of chronic tonsillitis. PMID: 24496565
  56. The damaging rs3732378 variant in the CX3CR1 chemokine receptor was shared by all affected family members and by 15% of 28 sporadic hip dysplastics. PMID: 24998320
  57. These results demonstrate that the de novo CX3CL1-CX3CR1 axis plays a pivotal role in osteoclast recruitment and subsequent bone resorption PMID: 24401612
  58. The modulatory influence of TNFalpha on CX3CR1 expression in hypoxia and CX3CL1/CX3CR1 interaction may serve as a compensatory mechanism to preserve or augment the pro-inflammatory course of intercellular interactions in placental endothelium PMID: 24270813
  59. These results reveal a critical role for CXCR1 mononuclear phagocytes lymphoid cell production of IL-22. PMID: 25024136
  60. Data show that chemokine (C-X3-C motif) receptor 1 (CX3CR1) expression is associated with the process of cellular migration in vitro and tumor metastasis of clear cell renal cell carcinoma (CCRCC) in vivo. PMID: 23570708
  61. Specific chemokine receptor polymorphisms of the recipient are associated with development of post-liver transplantation biliary strictures. PMID: 22550960
  62. Circulating levels of CX3CR1 receptor on CD4 T cells was a strong predictor of cardiovascular mortality. PMID: 24342397
  63. In a microenvironment lacking CX3CR1, the liver metastasis of colon cancer cells is significantly inhibited. PMID: 24245985
  64. Many progressive neuroinflammatory disorders that are associated with increased microglial activation show disruption of the FKN/CX(3)CR1 communication. Thus, targeting CX(3)CR1 receptor in such diseases may eventually lead to novel neurotherapeutics. PMID: 24352739
  65. rs3732378 causes a threonine (polar) to methionine (non-polar) alteration at position 280 in the transmembrane domain of CX3CR1, causing developmental dysplasia of the hip. PMID: 23716478
  66. This study identified for the first time that increases in CX3CL1 and CX3CR1-expressing cells are significantly related to ligamentum flavum hypertrophy. PMID: 24060055
  67. The presence of CX3CR1 polymorphisms could influence the incidence and the outcome of acute myocardial infarction PMID: 24307998
  68. Tolerogenic CX3CR1+ B cells suppress food allergy-induced intestinal inflammation in mice. PMID: 24033604
  69. CX3CR1 mRNA was upregulated in Sjogren's patients' salivary glands. PMID: 24324211
  70. CX3CL1/CX3CR1 reprograms glucose metabolism through HIF-1 pathway in pancreatic cancer cells. PMID: 23857671
  71. Interactions between CX3CL1 and CX3CR1 may contribute to the development of leukocytoclastic vasculitis. PMID: 23470165
  72. studies support an important pathogenic role of CX3CL1/CX3CR1 in atherogenesis and plaque destabilization PMID: 23974513
  73. This study failed to identify significant associations between common CX3CR1 variants and age-related macular degeneration after considering the number of SNPs analyzed and multiple comparisons. PMID: 24287500
  74. CX3CL1 and CX3CR1 signaling may have a role in the pathomechanism of placental microvasculature remodeling in diabetes class C PMID: 23956503
  75. Cytokines significantly increased CX3CL1 but not CX3CR1 expression. PMID: 24084767
  76. In humans, the dysfunctional CX3CR1 allele CX3CR1-M280 was associated with increased risk of systemic candidiasis. PMID: 24177428
  77. Our results highlight a novel role for CX3CR1 in NK cell migration that may contribute to the NK cell trafficking to the allergic upper airway. PMID: 23414540
  78. Fractalkine and its receptor CX3CR1 are expressed in the human brain after traumatic brain injury and intracranial hemorrhage and may be involved in the limitation of tissue damage. PMID: 23584220
  79. This study analysis revealed up-regulation of CD14, CD18, CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36, CX3CR1, CX3CL1 and CD200 in postmenopausal women. PMID: 23206327
  80. In contrast to CX3CR1, which promotes efficient cell capture upon binding to anchored CX3CL1, US28 acts to increase the migration of cells upon binding to the same ligand. PMID: 23303826
  81. CX3CR1 was found to be abundantly expressed in human meningioma samples of different malignant grades. PMID: 23229614
  82. resistin contributes to the pro-inflammatory state of SMC by the up-regulation of CX3CL1 and CX3CR1 expression via a mechanism involving NF-kB, AP-1, and STAT1/3 transcription factors, (2) resistin employs TLR4 and Gi-protein signaling. PMID: 23086480
  83. No polymorphism study about the fractalkine receptor which is a chemokine and plays an important role in neuroinflammation and neurodegeneration. PMID: 22916723
  84. In this Greek population, after adjusting for known risk factors, increased risk of geographic atrophy (GA) AMD among the carriers of the V249I polymorphism in the CX3CR1 gene was found. PMID: 22816662
  85. CX3CR1 gene polymorphism is associated with a higher rate of cancer in renal transplant recipient (RTR). PMID: 23388733
  86. In the present coronary artery disease population, no differences in circulating levels of fractalkine or expression levels of CX3CR1 were observed between patients with and without T2DM, or with and without metabolic syndrome. PMID: 22897138
  87. HIF-1 and NF-kappaB are essential for hypoxia-regulated CX3CR1 expression, which is associated with increased migratory and invasive potential of prostate cancer cells. PMID: 22941344
  88. the polymorphisms of CX3CR1 might not associate with the occurrence, neurological rehabilitation and 3-month outcome of cerebral infarction in the Han Chinese population PMID: 22748631
  89. Hypoxia-inducible factor-1alpha regulates chemotactic migration of pancreatic ductal adenocarcinoma cells through directly transactivating the CX3CR1 gene PMID: 22952674
  90. Chemokine fractalkine receptor CX3CR1 binds directly to integrins alpha4beta1 and alphav4beta3 with very high affinity. PMID: 23125415
  91. CX3CR1 is upregulated in NSCLC metastatic disease and its expression in primary lung tumours relates inversely to organotropic spread of cancer cells to the brain and the liver. PMID: 22614623
  92. CX3CR1 V249I and T280M polymorphisms do not increase susceptibility to PD. Additional studies should further investigate the CX3CL1-CX3CR1 axis in PD PMID: 22747084
  93. Upregulation of glomerular and urinary fractalkine suggests an involvement of the CX3CR1-fractalkine axis in the exacerbation of gross hematuria in patients with IgA nephropathy. PMID: 22572859
  94. Fractalkine is expressed in early and advanced atherosclerotic lesions and supports monocyte recruitment via CX3CR1. PMID: 22916279
  95. the CX3CR1 chemokine receptor is frequently detected in normal mammary glands where its expression and distribution increases with malignant transformation PMID: 21933397
  96. Overall survival was worse for patients with pancreatic ductal adenocarcinoma with the combined high expression of CX3CL1 and CX3CR1. High CX3CR1 expression was an independent negative prognosis factor. PMID: 22639377
  97. Use of cx3cr1 transgenic mice in a pulmonary emphysema model demonstrates requirement of functional CX3CR1 for a subset of tissue-bound mononuclear phagocytes to produce tumor necrosis factor (TNF)-alpha and interleukin (IL)-6 in response to cigarette smoke. PMID: 21278339
  98. the risk of early onset of CAD is associated with a genetic variation in chemokine receptor CX3CR1. PMID: 22731642
  99. CX3CR1 is functional, as all the tumor cell lines adhere to immobilized recombinant CX3CL1 and migrate in response to the soluble form of this chemokine. PMID: 20511186
  100. HIV-associated atherosclerosis may be driven by a positive feedback pathway in which a high frequency of antigen-stimulated, CMV-specific CD4(+)CX3CR1(+) T cells induce endothelial cells to secrete CX3CL1 PMID: 22313962

Show More

Hide All

Involvement in disease Macular degeneration, age-related, 12 (ARMD12)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in lymphoid and neural tissues.
Database Links

HGNC: 2558

OMIM: 601470

KEGG: hsa:1524

STRING: 9606.ENSP00000351059

UniGene: Hs.78913

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1