Recombinant Human Platelet glycoprotein 4(CD36)

Code CSB-CF004927HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16671
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence GCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Source in vitro E.coli expression system
Gene Names CD36
Protein Names Recommended name: Platelet glycoprotein 4 Alternative name(s): Fatty acid translocase Short name= FAT Glycoprotein IIIb Short name= GPIIIB Leukocyte differentiation antigen CD36 PAS IV PAS-4 Platelet collagen receptor Platelet glycop
Expression Region 2-472
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity)
Involvement in disease Platelet glycoprotein IV deficiency (PG4D); Coronary heart disease 7 (CHDS7)
Subcellular Location Cell membrane, Multi-pass membrane protein, Membrane raft, Golgi apparatus, Apical cell membrane
Protein Families CD36 family
Database Links

HGNC: 1663

OMIM: 173510

KEGG: hsa:948

STRING: 9606.ENSP00000308165

UniGene: Hs.120949

Pathway PPAR signaling pathway
Lipids and Inflammation in Atherogenesis
Hematopoietic cell lineage
Adipocytokine signaling pathway
AMPK signaling
Cholesterol metabolism
ER Stress pathway

Related Products

CD36 Antibodies

CD36 Antibodies for Human

CD36 Antibodies for Homo sapiens (Human)

CD36 Proteins

CD36 Proteins for Homo sapiens (Human)

CD36 ELISA Kit

CD36 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.