Recombinant Mouse Natural killer cells antigen CD94(Klrd1)

Code CSB-CF012470MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Klrd1
Uniprot No. O54707
Alternative Names Klrd1; Cd94Natural killer cells antigen CD94; Killer cell lectin-like receptor subfamily D member 1; CD antigen CD94
Species Mus musculus (Mouse)
Expression Region 1-179
Target Protein Sequence MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Gene References into Functions
  1. Segregation of a spontaneous Klrd1 mutation in DBA/2 mouse substrains PMID: 25520036
  2. The transmembrane region sequences of CD94 and NKG2 in mouse and rat differ markedly from other mammalian orthologs by the presence of a lysine residue in the transmembrane region. PMID: 22084441
  3. show that CD94, a molecule preferentially expressed by NK cells, is essential for the resistance of C57BL/6 mice to mousepox, a disease caused by the Orthopoxvirus ectromelia virus PMID: 21439856
  4. CD94 and NKG2 were both expressed early in NK cell development, sometimes in the absence of NK1.1, with CD94 invariably being expressed at two different levels. IL-4 differentially inhibited the expression of CD94 and Ly49 receptors. PMID: 11870631
  5. Inhibitory receptor CD94 is expressed on mature fetal thymic and adult epidermal TCR Vgamma3+ lymphocytes. PMID: 11907085
  6. The acquisition of individual receptor gene expressions during various stages of differentiation in culture from embryonic stem cells to NK cells follows a predetermined order, with the order of receptor acquisition being first CD94. PMID: 11994449
  7. There is no evidence that CD94 inhibits either the lytic function of lymphocytic choriomeningitis virus-specific T cells or their capacity to produce effector cytokines upon peptide stimulation. PMID: 12097371
  8. The engagement of the activating isoforms of C-type lectin inhibitory receptor (CD94)by their natural ligands, represented by soluble HLA-I molecules, induced programmed cell death of natural killer cells PMID: 12393468
  9. CD94 heterodimers costimulate effector functions of differentiated Th1 cells, but not Th2 cells. PMID: 12421909
  10. A high level of expression of CD94/NKG2 receptors is correlated with a lower level of apoptosis and may play an important role in the maintenance of CD8 T and NK cells. PMID: 12574337
  11. Identification of a novel second CD94 upstream CD94 promoter and the observation that various lymphoid cells use the two promoters differentially offer a theoretical mechanism for the expression of NK receptors on non-NK cells. PMID: 14530345
  12. CD94-expressing anti-polyoma virus CD8 T cells appear to be essential for antigen-specific recall responses in mice persistently infected by polyoma virus. PMID: 16670321
  13. CD94 is an Ag that can be used to identify functionally distinct NK cell subsets in mice and could also be relevant to late-stage mouse NK cell development. PMID: 19801519

Show More

Hide All

Subcellular Location Membrane, Single-pass type II membrane protein
Database Links

KEGG: mmu:16643

STRING: 10090.ENSMUSP00000107694

UniGene: Mm.391515

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1