Recombinant Mouse Natural killer cells antigen CD94(Klrd1)

Code CSB-CF012470MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O54707
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Source in vitro E.coli expression system
Gene Names Klrd1
Protein Names Recommended name: Natural killer cells antigen CD94 Alternative name(s): Killer cell lectin-like receptor subfamily D member 1 CD_antigen= CD94
Expression Region 1-179
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Subcellular Location Membrane, Single-pass type II membrane protein
Database Links

KEGG: mmu:16643

STRING: 10090.ENSMUSP00000107694

UniGene: Mm.391515

Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

Klrd1 Proteins

Klrd1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.