Recombinant Mouse Somatostatin receptor type 2 (Sstr2)

Code CSB-CF022725MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Sstr2; Smstr2; Sst2; Somatostatin receptor type 2; SS-2-R; SS2-R; SS2R; SRIF-1
Species
Mus musculus (Mouse)
Expression Region
1-369
Target Protein Sequence
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Gene References into Functions
  1. Both hippocampal sst2 and sst4 receptors selectively inhibit stress-induced HPA axis activation but mediate anxiolytic and antidepressive effects through distinct mechanisms. PMID: 27986975
  2. Loss of sst2 from pancreatic tissues activates PI3K signaling via AKT, leading to activation of NF-kappaB, amplification of oncogenic KRAS signaling, increased expression of CXCL16, and pancreatic tumor formation. PMID: 25683115
  3. SST2 expression protects against gentamicin-induced auditory hair cell loss in the mammalian inner ear. PMID: 25268135
  4. Knock-down of SSTR2 leads to loss of pluripotency in murine embryonic stem cells. PMID: 24998255
  5. Inhibition of the Sstr2 receptor reversed the anticonvulsant effect mediated by cortistatin-14. PMID: 24685142
  6. OCT-P407 induces mRNA expression of SSTR-2 and caspase-3 and decreases that of VEGF in mice. PMID: 24173662
  7. The study encourages the use of liver tissue SSR2 protein and mRNA as a reliable tumor marker for liver cancer PMID: 24163059
  8. The aim of this study was to validate an animal model expressing SSTR2 and to correlate the immunohistochemical (IHC) analysis with (18)F-FDG and (68)Ga-DOTATOC uptake in vivo. PMID: 23898054
  9. SSTR2 was expressed in Kolliker's organ on E14, on cochlear duct hair cells & supporting cells on E17 and only on the organ of Corti at birth, increasing & peaking at P14 but dropping off at P21. PMID: 22986312
  10. SSTR2 was well expressed in most of the hypothalamic regions whereas it decreases significantly in ventromedial and arcuate nucleus of ApoD(-/-) mice. PMID: 22581439
  11. sst2 may protect retinal cells from hypoxia, thus implementing the background to establish potential pharmacological targets. PMID: 22311350
  12. somatostatin receptors demonstrate specific expression in HCs and supporting cells of the mouse cochlea, and that absence of SST1 alters the expression of SST2. PMID: 21896184
  13. SSTR2-based reporters can serve as reporters of gene transfer into non-small cell lung cancer. PMID: 20653396
  14. Overexpressed in endomterium inendometriosis. PMID: 20739383
  15. sst(2a) and sst(4) were respectively detected in the dentate gyrus (DG) and the CA1 subfield suggesting that their functional interactions are not mediated by direct receptor coupling PMID: 19623609
  16. Data indicate that OcF showing high-affinity binding to the sstr2. PMID: 20233796
  17. sst(2) receptors mediate inhibition of peristalsis in the jejunum PMID: 11897621
  18. The somatostatin receptor subtype 2a (SSR(2(a))) was found in the cytoplasm and the plasma membrane of catecholaminergic CAD-cells. After serum deprivation, SSR(2(a)) was up-regulated in the cells. PMID: 12441163
  19. Somatostatin 2 receptors are expressed in neurons and endocrine cells in the stomach and the small and large intestine. PMID: 12442323
  20. Sst2 activation inhibits the AMPA component of glutamatergic synaptic responses. Decrease of AMPA currents induced by octreotide requires a concomitant activation of sst2 receptors with either NMDA and/or metabotropic glutamate receptors. PMID: 12509482
  21. omatostatin regulates ductal bile formation in mice by inhibition of ductal fluid secretion, also by stimulation of ductal fluid absorption via interacting with SSTR2 on cholangiocytes, a process involving the intracellular cAMP/cGMP second messengers. PMID: 12676656
  22. In the striatum, Sstr2 expression is identified in medium spiny projection neurons restricted to the matrix compartment and in cholinergic interneurons. PMID: 12752788
  23. Evidence is provided that the overexpression of sst2 receptors has a profound impact on the sst2-mediated modulation of membrane excitability and neurotransmitter release in the mouse retina. PMID: 15464758
  24. somatostatin receptor subtype-2 is responsible for somatostatin binding in cortical and amygdaloid regions PMID: 15544857
  25. We provide direct evidence for activation of SSTR2 by an endogenous ligand after focal ischemia, which contributes to increased SSTR2 gene expression and postischemic neurodegeneration. PMID: 15601946
  26. role of somatostatin receptor subtype 5 on somatostatin receptor subtype 2 action in pituitary tumor cells PMID: 15857828
  27. the presence of sst(5) in the same cells modulates trafficking and cell surface regulation of sst(2A) and cellular desensitization to the effects of SRIF PMID: 17272399
  28. sst2 deficiency is associated with exaggerated jejunal afferent sensitivity to mechanical/chemical stimulation, suggesting that somatostatin plays an inhibitory role to control visceral sensitivity by interacting with the sst2 receptor. PMID: 17363388
  29. Decreased afferent responses to somatostatin receptor 2 stimulation correlated with lower expression of vagal somatostatin receptor 2 in stressed Nb-infected mice, confirming a link between molecular data and functional sequelae. PMID: 17408648
  30. Increased glucagon concentration is associated with impaired glucose control in sst2(-/-) mice, resulting from decreased hepatic glucose storage, increased glycogen breakdown, and reduced lipid accumulation PMID: 17525126
  31. Acute EAE disrupts the rat striatal SRIF receptor-effector system, providing insight into the molecular basis of EAE, leading to a better understanding of human multiple sclerosis. PMID: 17630220
  32. sst(2) may be protective against retinal angiogenesis PMID: 17652715
  33. The functional interactions between human somatostatin receptor 2 (hSSTR2) and human dopamine receptor 2 (hD2R) in both co-transfected CHO-K1 or HEK-293 cells as well as in cultured neuronal cells which express both the receptors endogenously. PMID: 17706924
  34. there is a remodeling of the neuroendocrine mechanisms that regulate acid secretion in mutant mice lacking SSTR2 PMID: 17974627
  35. Data show that a reconsideration of the role of SSTR2 in the GI somatostatinergic effects is in order and further corroborate recent data on the role of other SSTR subtypes in the inflammatory effects of SOM during intestinal inflammation. PMID: 18298437
  36. The somatostatin type 2A receptor is mobile and rapidly and laterally diffuses in hippocampal neuronal membranes. PMID: 18434512
  37. SSTR2 is the predominant mediator of functional ocular antiangiogenic effects. PMID: 18599562
  38. These results demonstrate that sst(2) activation protects against retinal ischaemia. However, in the presence of sst(2) over-expression sst(2) is functionally desensitised by agonists, possibly because of sustained RGS1 levels. PMID: 18624922
  39. These results suggest that, in the adult mouse, testosterone is a major modulator of sst2A distribution on GHRH neurones. PMID: 18752655

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Cerebrum and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1