Recombinant Human Platelet-derived growth factor subunit A(PDGFA)


In Stock
Code CSB-AP003941HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P04085
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Alias Platelet-derived growth factor subunit A;PDGF subunit A;PDGF-1;Platelet-derived growth factor A chain;Platelet-derived growth factor alpha polypeptide; PDGFA;PDGF1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Research Area Cancer
Source E.coli
Gene Names PDGFA
Expression Region 87-211aa
Tag Info Tag-Free
Mol. Weight 14.1 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB (By similarity).
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family
Database Links

HGNC: 8799

OMIM: 173430

KEGG: hsa:5154

STRING: 9606.ENSP00000346508

UniGene: Hs.535898

Pathway Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Ras signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

PDGFA Antibodies

PDGFA Antibodies for Homo sapiens (Human)

PDGFA Proteins

PDGFA Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.