Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

In Stock
Code CSB-MP855470HUh7
Abbreviation Recombinant Human CLEC4C protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU),the EC50 is 7.658-12.99 ng/mL. Biological Activity Assay
  • CLEC4C Recombinant Monoclonal Antibody (CSB-RA855470MA1HU) captured on Protein A Chip can bind Recombinant Human CLEC4C protein with an affinity constant of 0.188 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU),the EC50 is 7.658-12.99 ng/mL.
Target Names
Uniprot No.
Alternative Names
Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL;
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Mol. Weight
24.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human CLEC4C protein is generated through a mammalian cell expression system. The human CLEC4C gene fragment (45-213aa), coupled with an N-terminal 6xHis-tag gene, is integrated into a plasmid vector and then introduced into mammalian cells. Post-transfection, the cells undergo cultivation to facilitate protein expression. The resultant recombinant human CLEC4C protein is verified for purity exceeding 95% via SDS-PAGE. Its endotoxin content, measured using the LAL method, is confirmed to be under 1.0 EU/ug, ensuring high quality. The protein's interaction capability is evaluated using CLEC4C recombinant antibody (CSB-RA855470MA1HU), with the EC50 of 7.658-12.99 ng/mL.

CLEC4C is a novel plasmacytoid dendritic cell (pDC)-specific type II C-type lectin that mediates antigen capture and serves as an effective inhibitor of interferon-alpha/beta induction. It can also efficiently target ligands for antigen processing and peptide loading compartments to present to T cells. As the sole receptor expressed on pDCs, CLEC4C can reduce the production of inflammatory cytokines, including IFN-I, playing a significant regulatory role in the pathogenesis of lupus. In autoimmune diseases, beyond systemic lupus erythematosus, conditions like Sjögren's syndrome, alopecia areata, vitiligo, and polymyositis are also associated with CLEC4C. High levels of CLEC4C+ pDCs have been identified in muscle fibers of patients with polymyositis, dermatomyositis, and other inflammatory myopathies. CLEC4C exhibits significant potential for the treatment of these diseases. Therefore, developing active CLEC4C protein can aid in clinical drug development and testing.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Gene References into Functions
  1. Identification of serum glycoprotein ligands for the immunomodulatory receptor blood dendritic cell antigen 2. PMID: 29796630
  2. decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047
  3. Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
  4. BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448
  5. We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442
  6. Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416
  7. Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572
  8. Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719
  9. Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634
  10. Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
  11. Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303
  12. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  13. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864
  14. results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674
  15. Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*