Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial

In Stock
Code CSB-YP855470HU
Abbreviation Recombinant Human CLEC4C protein, partial
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.0kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human C-type lectin domain family 4 member C (CLEC4C) is produced using a yeast expression system and covers the extracellular domain from amino acids 45 to 213. The protein comes with an N-terminal 6xHis-tag and reaches purity levels above 90% based on SDS-PAGE analysis, which appears to provide high-quality material for research purposes. The recombinant protein seems well-suited for various applications given its consistent production and purity standards.

CLEC4C, which researchers also know as CD303, belongs to the C-type lectin family and likely plays a crucial role in immune system function. It's found mainly on plasmacytoid dendritic cells and is involved in recognizing glycan structures. The protein appears to participate in immune response modulation, making it particularly relevant for studies examining immune signaling pathways and how pathogens interact with host cells. Its role in innate immunity suggests it may be important for understanding how the immune system functions and regulates itself.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant CLEC4C extracellular domain can work as an immunogen for creating specific antibodies against human CLEC4C. It might also serve as a standard protein for validating antibodies that already exist. The N-terminal 6xHis tag makes purification and immobilization straightforward for ELISA-based antibody screening and characterization assays. High purity levels (>90%) should provide reliable and reproducible results throughout antibody development workflows. The yeast expression system appears to maintain proper protein folding of the extracellular domain, which may make it suitable for generating antibodies that recognize native CLEC4C conformations.

2. Protein-Protein Interaction Studies

Researchers could use the purified CLEC4C extracellular domain in pull-down assays to identify potential binding partners or ligands that interact with this C-type lectin domain. The 6xHis tag makes immobilization on nickel-based resins easier for affinity purification experiments with cell lysates or purified protein libraries. Surface plasmon resonance (SPR) or bio-layer interferometry studies might employ this recombinant protein to characterize binding kinetics and affinities with known or suspected interaction partners. Such studies would likely contribute to understanding how CLEC4C recognizes molecules at the molecular level.

3. Structural and Biophysical Characterization

This recombinant protein could work well as a substrate for structural biology studies. These might include X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to determine the three-dimensional structure of the CLEC4C extracellular domain. The high purity and defined boundaries (45-213aa) appear to make it suitable for biophysical analyses like dynamic light scattering, circular dichroism spectroscopy, and thermal stability assays. Mass spectrometry analysis should confirm the protein's molecular weight and any post-translational modifications it acquires during yeast expression.

4. Lectin Activity and Carbohydrate Binding Assays

Since CLEC4C belongs to the C-type lectin family, this recombinant extracellular domain may be useful in glycan array screening or carbohydrate binding assays to identify specific sugar ligands. Researchers can immobilize the protein through its 6xHis tag on microplates or biosensor surfaces for systematic screening against carbohydrate libraries. These studies would likely help define CLEC4C's carbohydrate recognition specificity and binding preferences. The results might inform our understanding of how CLEC4C functions in glycan recognition pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Gene References into Functions
  1. Identification of serum glycoprotein ligands for the immunomodulatory receptor blood dendritic cell antigen 2. PMID: 29796630
  2. decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047
  3. Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
  4. BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448
  5. We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442
  6. Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416
  7. Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572
  8. Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719
  9. Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634
  10. Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
  11. Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303
  12. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  13. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864
  14. results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674
  15. Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*