Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial

In Stock
Code CSB-YP855470HU
Abbreviation Recombinant Human CLEC4C protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.0kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human C-type lectin domain family 4 member C (CLEC4C) is produced using a yeast expression system and covers the extracellular domain from amino acids 45 to 213. The protein comes with an N-terminal 6xHis-tag and reaches purity levels above 90% based on SDS-PAGE analysis, which appears to provide high-quality material for research purposes. The recombinant protein seems well-suited for various applications given its consistent production and purity standards.

CLEC4C, which researchers also know as CD303, belongs to the C-type lectin family and likely plays a crucial role in immune system function. It's found mainly on plasmacytoid dendritic cells and is involved in recognizing glycan structures. The protein appears to participate in immune response modulation, making it particularly relevant for studies examining immune signaling pathways and how pathogens interact with host cells. Its role in innate immunity suggests it may be important for understanding how the immune system functions and regulates itself.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant human CLEC4C extracellular domain (45–213aa) expressed in yeast with an N-terminal 6×His tag is highly likely to fold correctly because it represents a secreted extracellular domain—a protein type that yeast expression systems generally handle well. Yeast can perform disulfide bond formation and limited glycosylation, both critical for the folding and stability of lectin domains. Therefore, the expressed protein may retain near-native conformation and potential carbohydrate-binding activity, though its bioactivity must be experimentally validated (e.g., through glycan binding assays or circular dichroism spectroscopy). In summary, the probability of correct folding is high, but it cannot be assumed without direct verification.

1. Antibody Development and Validation Studies

This recombinant CLEC4C extracellular domain is well-suited as an immunogen for producing antibodies against human CLEC4C or for validating existing antibodies. The N-terminal 6×His tag facilitates purification and immobilization in ELISA or Western blot assays, and >90% purity ensures reliability across experiments. If correctly folded, this protein can elicit and detect antibodies that recognize native, conformational epitopes of CLEC4C. If misfolded, it will still serve effectively for generating linear-epitope antibodies, suitable for denatured assays like Western blotting. Thus, while folding is likely correct due to the yeast system’s secretion capacity, antibody binding to native CLEC4C should be confirmed empirically.

2. Protein-Protein Interaction Studies

The purified CLEC4C extracellular domain can be used to identify binding partners or ligands if the protein retains its native conformation. The 6×His tag simplifies immobilization for pull-down, SPR, or bio-layer interferometry assays. However, because the binding specificity of lectin domains depends heavily on correct disulfide pairing and glycosylation, experimental validation of folding and carbohydrate-recognition competence is required before assuming functional activity. If folding validation is lacking, the fragment should be used only for preliminary binding screening, not for quantitative affinity or mechanistic studies.

3. Structural and Biophysical Characterization

This recombinant extracellular domain is a suitable candidate for structural and biophysical studies if it is confirmed to be properly folded. Its defined amino acid boundaries (45–213aa) and >90% purity make it amenable to crystallography, NMR, or CD spectroscopy. However, yeast-derived glycosylation can sometimes interfere with crystallization or cause heterogeneity, so deglycosylation treatment or expression optimization may be necessary. Without confirmation of correct folding and homogeneity, it should not be used for high-resolution structure determination.

4. Lectin Activity and Carbohydrate Binding Assays

If the recombinant protein is correctly folded, it can be used in glycan array screening or carbohydrate binding assays to define CLEC4C’s ligand specificity. The 6×His tag allows easy immobilization for biosensor or microplate-based assays. If folding or glycosylation is incomplete, the protein might show reduced or absent lectin activity despite structural integrity. Therefore, functional glycan binding must be empirically verified before assuming activity.

Final Recommendation & Action Plan

The recombinant human CLEC4C extracellular domain is very likely to be correctly folded and partially bioactive, given that yeast can produce functional extracellular lectins with proper disulfide formation. It is well-suited for antibody generation, validation studies, and potential carbohydrate-binding assays, provided folding is confirmed through secondary structure and binding analyses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Gene References into Functions
  1. Identification of serum glycoprotein ligands for the immunomodulatory receptor blood dendritic cell antigen 2. PMID: 29796630
  2. decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047
  3. Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
  4. BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448
  5. We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442
  6. Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416
  7. Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572
  8. Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719
  9. Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634
  10. Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
  11. Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303
  12. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  13. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864
  14. results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674
  15. Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*