Home
Active Protein
Other
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

^{In Stock}

Code	CSB-EP855470HU
Abbreviation	Recombinant Human CLEC4C protein, partial (Active)
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC₅₀ of human CLEC4C antibody is 31.43-43.52 μg/ml. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.

Target Names

CLEC4C

Uniprot No.

Q8WTT0

Research Area

Immunology

Alternative Names

CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

45-213aa

Target Protein Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Mol. Weight

36.0 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the possibilities of our high-quality Recombinant Human CLEC4C protein, also known as C-type lectin domain family 4 member C or CD303, for your immunology research applications. Derived from E.coli, this extracellular domain protein (45-213aa) features an N-terminal 6xHis-SUMO tag, facilitating efficient detection and purification. With a purity of >90% as determined by SDS-PAGE, this protein ensures reliable performance in your experiments. The biological activity of Recombinant Human CLEC4C is demonstrated by its binding ability in a functional ELISA, with an EC₅₀ of 31.43-43.52 μg/ml for immobilized CLEC4C binding to the human CLEC4C antibody. Provided as a lyophilized powder, our Recombinant Human CLEC4C protein empowers you to advance your immunology research with consistent results and precision scientific quality.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.

Gene References into Functions

Identification of serum glycoprotein ligands for the immunomodulatory receptor blood dendritic cell antigen 2. PMID: 29796630
decrease in the surface expression of CLEC4C and the endoplasmic reticulum localization of the mutant construct were observed PMID: 26943047
Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
BDCA-2 binds selectively to glycans containing the epitope Galbeta1-3/4GlcNAcbeta1-2Man. PMID: 25995448
We show the crystal structures of a carbohydrate recognition domain (CRD) of human C-type lectin receptor blood dendritic cell antigen-2 (BDCA2). PMID: 24425442
Reduction in Treg numbers following Ag delivery to BDCA2 restored both CD4(+) T cell activation and Ab responses, demonstrating that Tregs were required for the observed tolerance. PMID: 24829416
Data show that HCV envelope glycoprotein E2 is a novel ligand of blood dendritic cells antigen 2 (BDCA-2). PMID: 23053572
Human C-type lectin domain family 4, member C (CLEC4C/BDCA-2/CD303) is a receptor for asialo-galactosyl-oligosaccharides. PMID: 21880719
Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques. PMID: 21436634
Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
Indoleamine 2,3-deoxigenase positive plasmacytoid dentritic cells are the classical BDCA2 positive cells in melanoma lymph nodes PMID: 19829303
Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 and cytoskeletal proteins. CD303 signaling is linked with internalization by clathrin-mediated endocytosis. PMID: 18022864
results suggest that downregulation of BDCA2 expression on plasmacytoid dendritic cells (pDCs) may reflect the activation of pDCs accumulated in systemic lupus erythematosus patients & may be one marker for indication of disease activity of SLE patients PMID: 18684674
Engagement of BDCA-2 blocks TRAIL-mediated cytotoxic activity of plasmacytoid dendritic cells. PMID: 19577819

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.

Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

Promotions