Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.
Alternative Names
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Species
Homo sapiens (Human)
Expression Region
45-213aa
Target Protein Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Explore the possibilities of our high-quality Recombinant Human CLEC4C protein, also known as C-type lectin domain family 4 member C or CD303, for your immunology research applications. Derived from E.coli, this extracellular domain protein (45-213aa) features an N-terminal 6xHis-SUMO tag, facilitating efficient detection and purification. With a purity of >90% as determined by SDS-PAGE, this protein ensures reliable performance in your experiments. The biological activity of Recombinant Human CLEC4C is demonstrated by its binding ability in a functional ELISA, with an EC50 of 31.43-43.52 μg/ml for immobilized CLEC4C binding to the human CLEC4C antibody. Provided as a lyophilized powder, our Recombinant Human CLEC4C protein empowers you to advance your immunology research with consistent results and precision scientific quality.