Recombinant Human C-type lectin domain family 4 member C(CLEC4C),parial (Active)

In Stock
Code CSB-EP855470HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q8WTT0
Abbreviation CLEC4C
Relevance Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP855470HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
Storage Buffer Tris-based buffer,50% glycerol
Alias Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Research Area Immunology
Source E.coli
Gene Names CLEC4C
Protein Names Recommended name: C-type lectin domain family 4 member C Alternative name(s): Blood dendritic cell antigen 2 Short name= BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen= CD303
Expression Region 45-213aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 36.0kDa
Protein Description Extracellular Domain
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells
Subcellular Location Cell membrane, Single-pass type II membrane protein
Tissue Specificity Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Database Links

HGNC: 13258

OMIM: 606677

KEGG: hsa:170482

STRING: 9606.ENSP00000353500

UniGene: Hs.351812

Pathway Target Therapy

Related Products

CLEC4C Antibodies

CLEC4C Antibodies for Homo sapiens (Human)

CLEC4C Antibodies for Human

CLEC4C Proteins

CLEC4C Proteins for Homo sapiens (Human)

CLEC4C ELISA Kit

CLEC4C ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.