| Code | CSB-MP855470HU |
| MSDS | |
| Size | $318 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Regarding the 2 mg of Human CLEC4C proteinCSB-MP855470HU that we received against PO# cusabio11Dec17/1.
We have some questions that we hope you can urgently answer:
1) We are planning some Mass Spec work, which we cannot do without the following information. This work is part of our decision on whether to order more of the same lot# of this protein.
2) The protein has a His-tag. Could you please let us know the number of histidine residues and the location of the tag (i.e. N-terminus or C-terminus)?
3) Is the His Tag on the N-terminal or the C-terminal of the protein?
4) Is there a linker between the CD303 sequences and the His-Tag? If so, please can you provide the sequence of this linker?
5) Can you send us the full sequence of the recombinant protein? The website only provides the extra-cellular domain as reported in Uniprot.
DAAQPARRAVRSLEQKLISEEDLNSAVDHHHHHHRT+NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
We would like to know what mammalian cell line the protein is produced in, so we can predict the glycosylation that they expect from their mass spec.