Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA.Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL.

Target Names

CEACAM6

Uniprot No.

P40199

Research Area

Tags & Cell Markers

Alternative Names

(Non-specific crossreacting antigen)(Normal cross-reacting antigen)(CD66c)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

35-320aa

Target Protein Sequence

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Mol. Weight

32.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Human CEACAM6 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human CEACAM6 (35-320aa) was expressed with the C-terminal 10xHis tag. The purity of this CEACAM6 protein was greater than 95% as determined by SDS-PAGE. The activity was validated.

CEACAM6, which belongs to the carcinoembryonic antigen (CEA) family, is highly expressed in various solid tumors such as breast cancer, pancreatic cancer, colon cancer, and non-small cell lung cancer. CEACAM6 molecules can promote tumor metastasis, invasion and angiogenesis, inhibit tumor apoptosis, increase tumor drug resistance, and its high expression often indicates poor prognosis of patients. The specific antibody against this molecule can significantly inhibit tumor invasion and metastasis, increase apoptosis, and increase the sensitivity of cells to chemotherapy drugs. Therefore, using CEACAM6 as a target is of great significance for the screening of tumor cells and the development and utilization of anti-tumor antibody drugs.

Target Background

Function

Cell surface glycoprotein that plays a role in cell adhesion and tumor progression. Intercellular adhesion occurs in a calcium- and fibronectin-independent manner. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. Plays a role in neutrophil adhesion to cytokine-activated endothelial cells. Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion. Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells.

Gene References into Functions

CEACAM6 promoted oral squamous cell carcinoma cell invasion, migration, cytoskeletal rearrangement, and metastasis via interaction with EGFR and enhancing it activation. PMID: 28892050
Studies provide evidence that dysregulated overexpression of CEACAM6 plays a role in several of the hallmarks of cancer, including uncontrolled proliferation, anoikis resistance, immune evasion, invasion and metastasis. [review] PMID: 29110374
Helicobacter pylori HopQ binds the amino-terminal IgV-like domain of human CEACAM1, CEACAM3, CEACAM5 or CEACAM6 proteins, thereby enabling translocation of the major pathogenicity factor CagA into host cells. PMID: 27748756
Here, the authors identify members of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family as receptors of Helicobacter pylori and show that HopQ is the surface-exposed adhesin that specifically binds human CEACAM1, CEACAM3, CEACAM5 and CEACAM6. PMID: 27748768
CD66c (KOR-SA3544) antigen expression of leukemic blasts in pediatric acute myeloid leukemia with TLS/FUS-ERG fusion transcript PMID: 28766906
Data suggest that the expression of these TSPAN8, LGALS4, COL1A2 and CEACAM6 in the whole blood may be useful in the detection of colorectal cancer (CRC). PMID: 26993598
expression is increased in severe asthma and primarily associated with airway epithelial cells and tissue neutrophils PMID: 28275137
a 7-gene signature was identified which correctly predicted the primary prefibrotic myelofibrosis group with a sensitivity of 100% and a specificity of 89%. The 7 genes included MPO, CEACAM8, CRISP3, MS4A3, CEACAM6, HEMGN, and MMP8 PMID: 27579896
In enterocytic C2BBe1 cells, Candida albicans caused a transient tyrosine phosphorylation of CEACAM1 and induced higher expression of membrane-bound CEACAM1 and soluble CEACAM6. PMID: 28292985
Monoclonal Antibody 1B5A5 Against CEACAM6 PMID: 27328063
western blot analysis results indicated that the 1B5A5 epitope is located within an amino-terminal domain of CEACAM6. These results raised the possibility that our approach could lead to discovery of novel biomarkers for the early stage of cancers in a relatively short period of time. PMID: 27172290
show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6 PMID: 26673628
Biliary CEACAM6 can identify patients with extrahepatic cholangiocarcinoma with a high degree of sensitivity and should be investigated further as a potential screening tool. PMID: 26974538
Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
CEACAM6 protein and mRNA were increased ~4-fold in lungs from infants with chronic lung disease as compared with controls. PMID: 26374831
vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID: 25872647
CEACAM6 increased the levels of phosphorylated AKT, which is involved in the progression of a variety of human tumors. PMID: 25398131
Data show that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) and forkhead box P3 (FOXP3) are associated with the malignant degree of pancreatic cancer. PMID: 26271985
Data indicate that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes angiogenesis in gastric cancer via focal adhesion kinase FAK signaling. PMID: 25703140
Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition. PMID: 25409014
CEACAM6 may be a valuable biomarker screening for gastric tumor and novel predictor for patients in advanced stages of gastric cancer PMID: 25299082
results suggested that CEACAM6 functions as an oncoprotein in gastric cancer and may be an important metastatic biomarker and therapeutic target PMID: 24492534
CEACAM6 expression was expressed in different molecular subtypes of breast cancer. Among different subtypes, the highest expression was found with HER2 positive cancers. PMID: 24186057
High carcinoembryonic cell adhesion molecule 6 expression is associated with malignant biliary stenoses. PMID: 23806607
our findings identified CEACAM6, which is regulated by miR-29a/b/c, as an important positive regulator of EMT in pancreatic cancer PMID: 23857344
CD66c expression appears useful only as a predictor of the Ph in adult patients (not in pediatric cases). PMID: 24014076
Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases. PMID: 24231528
these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer PMID: 23592399
CEACAM-6 plays an important role in the regulation of CD8+ T-cell responses against multiple myeloma. PMID: 23603913
CEACAM6 is significantly upregulated in colon cancer tissues and is closely associated with poor prognosis. PMID: 22975528
The expression of CD66c was significantly higher in colorectal cancer specimens than in normal colon. PMID: 23027178
CEACAM6 is focally overexpressed in a large fraction of human HNSCCs in situ. over-expression of CEACAM6 increases tumour growth and tumour initiating activity by suppressing PI3K/AKT-dependent apoptosis of HNSCC in a xenotransplant model of HNSCC. PMID: 23021083
High CEACAM6 expresssion is associated with inflammatory bowel disease. PMID: 21994005
a novel role for NA in enhancing host cell survival by activating the Src/Akt signaling axis via an interaction with carcinoembryonic antigen-related cell adhesion molecule 6/cluster of differentiation 66c (C6). PMID: 22396546
The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils. PMID: 22064717
CEACAM6 is expressed by alveolar and airway epithelial cells of human lung and is secreted into lung-lining fluid, where fully glycosylated protein binds to surfactant. PMID: 22037359
Despite its important role in bacterial attachment in ileal CD, no role was detected for CEACAM6 variants in IBD susceptibility or regarding an ileal CD phenotype PMID: 21559399
The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
High serum CEACAM6 is associated with gastric cancer. PMID: 21618249
CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance PMID: 20047061
Positivity for both leukemia-associated antigens CD66c and CD25 in combination can predict the presence of BCR/ABL rearrangement in pre-B cell acute lymphoblastic leukemia PMID: 20063526
Overexpression of CEACAM6 disrupts tissue architecture and blocks colonocyte differentiation PMID: 11896570
CEACAM6 subdomains involved in intercellular adhesion activity and subdomains involved in inhibition of cell differentation are identified and their respective activities are independently blocked. PMID: 12571231
CEACAM6 gene silencing reversed the acquired anoikis resistance of tumor cell lines and inhibited in vivo metastatic ability PMID: 14724575
overexpression among human malignancies, immunological targeting of this tumor antigen may have therapeutic applicability PMID: 15081416
the results show that recognition of CEA and CEACAM6, but not CEACAM1, is accompanied by tight attachment to bacteria of cell surface microvilli-like extensions PMID: 15130118
CEACAM6 is an important determinant of pancreatic adenocarcinoma malignant cellular behavior PMID: 15208677
Levels of CEACAM6 expression can modulate pancreatic adenocarcinoma cellular invasiveness in a c-Src-dependent manner PMID: 15316565
CD66c is regulated in a manner distinct from other myeloid antigens in childhood lymphoblastic leukemia PMID: 15826304
Data show that variants of Neisseria gonorrhoeae that bind to human carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) 1 and 6 failed to induce detachment and, instead, promoted enhanced host cell adhesion to the ECM. PMID: 16115956

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane. Cell surface.

Protein Families

Immunoglobulin superfamily, CEA family

Tissue Specificity

Expressed in neutrophils. Expressed in columnar epithelial and goblet cells of the colon. Expressed in numerous tumor cell lines (at protein level).

Database Links

HGNC: 1818

OMIM: 163980

KEGG: hsa:4680

STRING: 9606.ENSP00000199764

UniGene: Hs.466814

Code	CSB-MP005166HU
Abbreviation	Recombinant Human CEACAM6 protein (Active)
MSDS	MSDS Datasheet
Size	$102
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC₅₀ is 144.7-223.8 ng/mL. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC₅₀ is 0.9430-1.377 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage