Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA.Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL.
Research Area
Tags & Cell Markers
Alternative Names
(Non-specific crossreacting antigen)(Normal cross-reacting antigen)(CD66c)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
35-320aa
Target Protein Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human CEACAM6 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human CEACAM6 (35-320aa) was expressed with the C-terminal 10xHis tag. The purity of this CEACAM6 protein was greater than 95% as determined by SDS-PAGE. The activity was validated.
CEACAM6, which belongs to the carcinoembryonic antigen (CEA) family, is highly expressed in various solid tumors such as breast cancer, pancreatic cancer, colon cancer, and non-small cell lung cancer. CEACAM6 molecules can promote tumor metastasis, invasion and angiogenesis, inhibit tumor apoptosis, increase tumor drug resistance, and its high expression often indicates poor prognosis of patients. The specific antibody against this molecule can significantly inhibit tumor invasion and metastasis, increase apoptosis, and increase the sensitivity of cells to chemotherapy drugs. Therefore, using CEACAM6 as a target is of great significance for the screening of tumor cells and the development and utilization of anti-tumor antibody drugs.