Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.

Target Names

CEACAM8

Uniprot No.

P31997

Alternative Names

CGM6

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

35-320aa

Target Protein Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Mol. Weight

34.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CEACAM8, a granulocyte-specific glycoprotein implicated in neutrophil activation and tumor-immune interactions, presents technical challenges for recombinant production due to its heavily glycosylated extracellular architecture. This mammalian-expressed construct spans the full mature protein (residues 35–320) and demonstrates quantifiable antibody binding in functional ELISA, with an EC50 of 19.38–21.68 ng/mL against an anti-CEACAM8 recombinant antibody, confirming that native epitopes are accessible for immunological studies. The measured activity supports use in antibody development and validation workflows, where epitope integrity is critical, as well as in cell adhesion assays and immune cell trafficking models that depend on CEACAM8-mediated interactions with selectins or heterophilic binding partners. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in functional cell-based assays and in vitro binding experiments where contaminant interference must be minimized.

Target Background

Function

Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.

Gene References into Functions

Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID: 27863478
Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID: 23686079
The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID: 17909799
CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID: 18056392

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Cell surface.

Protein Families

Immunoglobulin superfamily, CEA family

Tissue Specificity

Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.

Database Links

HGNC: 1820

OMIM: 615747

KEGG: hsa:1088

STRING: 9606.ENSP00000244336

UniGene: Hs.41

Code	CSB-MP005168HU
Abbreviation	Recombinant Human CEACAM8 protein (Active)
MSDS	MSDS Datasheet
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU)，the EC₅₀ is 19.38-21.68 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage