Recombinant Human Ephrin type-B receptor 1 (EPHB1), partial (Active)

Discontinued
Code CSB-AP005501HU
MSDS
Size $184
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to binding Human EFNB2 used funtional ELISA is less than 100 ug/ml.
Target Names
EPHB1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cek 6; EK6; ELK; Elkh; EPH receptor B1; Eph tyrosine kinase 2; EPH-like kinase 6; Ephb1; EPHB1_HUMAN; Ephrin type B receptor 1; Ephrin type-B receptor 1; EPHT2; HEK 6; HEK6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; Tyrosine protein kinase receptor EPH 2; Tyrosine-protein kinase receptor EPH-2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
564-984aa
Complete Sequence
SRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA
Mol. Weight
48.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.
Gene References into Functions
  1. SUMOylation of EphB1 repressed activation of its downstream signaling molecule PKC-gamma, and consequently inhibited neuroblastoma tumorigenesis. PMID: 29550816
  2. investigate NET could modulate one's attention orientation to facial expressions, we categorized individuals according to the genotypes of the -182 T/C (rs2242446) polymorphism. Our results indicated that the -182 T/C polymorphism significantly modulated attention orientation to facial expressions, of which the CC genotype facilitated attention reorientation to the locations where cued faces were previously presented. PMID: 27541794
  3. some of the mutations found in EPHB1 may contribute to an increased invasive capacity of cancers. PMID: 28108514
  4. Association of EPHB1 rs11918092 with symptoms of schizophrenia in Chinese Zhuang and Han populations. PMID: 27028544
  5. The tumor-suppressor function of EphB1 is clinically relevant across many malignancies, suggesting that EphB1 is an important regulator of common cancer cell transforming pathways. PMID: 25944917
  6. In medulloblastoma cell lines, EphB1 downregulation or knockdown reduced cell growth, viability, cell-cycle regulator expression, and migration, but increased radiosensitivity and the percentage of cells in G1 phase of the cell cycle. PMID: 25879388
  7. Our results indicate that EphB1 may be involved in carcinogenesis of renal cell carcinoma PMID: 25120806
  8. The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies. PMID: 24716914
  9. The study presents the first structure of the EphB1 tyrosine kinase domain determined by X-ray crystallography to 2.5A. PMID: 24677421
  10. EphB1 and Ephrin-B could be regarded as independent good prognostic factors and important biological markers for Squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder. PMID: 24606480
  11. Our data indicate that loss of EphB1 protein is associated with metastasis and poorer survival in patients with serous ovarian cancer PMID: 24427352
  12. Low EphB1 expression is associated with glioma. PMID: 24121831
  13. EphB1 stimulation triggered approximately 50% serine-threonine PTEN dephosphorylation and PTEN-Cbl complex disruption, a process requiring PTEN protein phosphatase activity. PMID: 23118026
  14. No association is found for EPH receptor B1 and susceptibility to schizophrenia. PMID: 21041834
  15. EPHB1 polymorphisms may be associated with susceptibility to hepatocellular carcinoma in the Korean population. PMID: 21763378
  16. Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion. PMID: 21804545
  17. analysis of EphB1, EphB2, and EphB4-binding peptides interaction with antagonists with ephrin-like affinity PMID: 15722342
  18. The ubiquitin ligase Cbl induces the ubiquitination and lysosomal degradation of activated EphB1, a process requiring EphB1 and Src kinase activity. PMID: 18034775
  19. Transgenic EphB1 and ephrin-B3 cooperatively regulate the proliferation and migration of neural progenitors in the hippocampus. PMID: 18057206
  20. Loss of expression of EphB1 protein in gastric carcinoma is associated with invasion and metastasis PMID: 18424888
  21. EphB1 may have roles in the pathogenesis and development of colorectal cancer. PMID: 18931529

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Early endosome membrane. Cell projection, dendrite.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Tissue Specificity
Preferentially expressed in brain.
Database Links

HGNC: 3392

OMIM: 600600

KEGG: hsa:2047

STRING: 9606.ENSP00000381097

UniGene: Hs.116092

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*