Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.

Target Names

Gipr

Uniprot No.

Q0P543

Alternative Names

Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

19-134aa

Target Protein Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Mol. Weight

14.7 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene sequence encoding amino acids 19 to 134 of the mouse gastric inhibitory polypeptide receptor (Gipr) is combined with a 10xHis-tag gene sequence at its C-terminus and then integrated into a plasmid vector. This recombinant vector is introduced into mammalian cells, and the cells that have been transfected are carefully selected and cultured to facilitate the expression of the protein. The recombinant mouse Gipr protein is isolated from the cell lysate. This protein's purity surpasses 95%, as determined using SDS-PAGE analysis, and its endotoxin content is less than 1.0 EU/μg as assessed by the LAL method. The functional capacity of the protein is affirmed through a functional ELISA test. When immobilized at a concentration of 2 μg/mL, the mouse Gipr protein effectively binds with the anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), with an EC₅₀ of ranging from 8.622 to 11.36 ng/ml.

Gipr has a widespread distribution in the body, being expressed in organs like the pancreas, stomach, small intestine, adipose tissue, heart, and brain tissue, where many cells directly or indirectly control body weight. Activating the GIP-Gipr signaling pathway not only stimulates the secretion of insulin and glucagon-like peptide-1 but also promotes the proliferation and survival of pancreatic β-cells, playing a significant role in blood glucose regulation. The Gipr gene polymorphism is associated with elevated BMI and increased visceral fat content in the body. The mouse Gipr shares about 83% homology with the human Gipr, with relatively similar structure and function. Developing drugs to treat obesity is one of the most promising directions currently. Most of these processes require validation in preclinical mouse animal models, making the preparation of active mouse Gipr protein essential. Therefore, preparing the mouse Gipr contributes to the development of drugs with cross-species reactivity and further aid in clinical drug research and development.

Target Background

Function

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

The study provides evidence that the insulinotropic action of zfGIP in mammalian systems involves activation of both the GLP-1 and the GIP receptors but not the glucagon receptor PMID: 29157578
Microarray analysis revealed that pregnancy-specific glycoprotein 17 (Psg17), a potential CD9-binding partner, was significantly decreased in GIP receptor-knockout (Gipr-/-) testes. PMID: 28430907
GIPR signaling in adipose tissue plays a critical role in high fat diet-induced insulin resistance and hepatic steatosis in vivo, which may involve IL-6 signaling. PMID: 28096257
Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose. PMID: 27020250
Results suggest the beneficial effects of glucose-dependent insulinotropic polypeptide on periodontal disease. PMID: 27181102
Gipr(-/-) offspring of mice exposed to high fat diet(HFD) during pregnancy/lactation became insulin resistant and obese and exhibited increased adipose tissue inflammation and decreased peripheral tissue substrate utilization after reintroduction of HFD. PMID: 26631738
Beta-cell Gipr KO mice exhibit lower levels of meal-stimulated insulin secretion, decreased expansion of adipose tissue mass and preservation of insulin sensitivity and decreased TCF1 expression. PMID: 26642437
Gipr is expressed in healthy arteries, predominantly in endothelial cells. PMID: 26395740
These data highlighted the importance of intact GIPR signalling and dietary composition in modulating memory and learning, and hippocampal pathways involved in the maintenance of synaptic plasticity PMID: 25760229
Functional GIP receptors play a major role in islet compensatory response to high fat feeding in mice. PMID: 25688757
our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2. PMID: 24866833
Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID: 25047836
Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID: 23689510
a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID: 22027838
Gipr is essential for adrenal steroidogenesis and links high fat (HF) feeding to increased levels of corticosterone, reduced glucocorticoid levels do not significantly contribute to the enhanced metabolic phenotypes in HF-fed Gipr(-/-) mice. PMID: 22043004
GIPR(dn) transgenic mice show a disturbed expansion of the endocrine pancreas, due to perturbed islet neogenesis. PMID: 21818396
GIP receptors play an important role in cognition, neurotransmission, and cell proliferation. PMID: 21273318
Both GIPR protein and mRNA expression increased during cell differentiation, and this increase was associated with upregulation of nuclear levels of SREBP-1c and PPARgamma, as well as acetylation of histones H3/H4. PMID: 21245029
GIPR(-/-) mice exhibit altered islet structure and topography and increased islet sensitivity to glucagon-like peptide-1 despite a decrease in pancreatic insulin content and gene expression PMID: 12540373
Results demonstrate that glucose intolerance was additively increased during oral glucose absorption when both gastric inhibitory polypeptide receptors and glucagon-like peptide 1 receptors were inactivated. PMID: 14966573
intact signaling of G-protein coupled receptors is involved in postnatal islet and beta-cell development and neogenesis of the pancreatic islets PMID: 15582721
Adult GIP receptor knock-out mice exhibit a significantly lower number of newborn cells in the hippocampal dentate gyrus compared with wild-type mice. PMID: 15716418
long term activation of the GIP receptor by daily treatment with N-AcGIP(LysPAL37) improved glucose tolerance due to enhancement of pancreatic beta cell glucose responsiveness and insulin secretion. PMID: 16181707
Both incretins secretion depends on mechanisms involving their own receptors and GLP-1 further requires GLUT2. PMID: 17681422
relative reduction of truncated GIPR expression may be involved in hypersensitivity of GIPR and hyperinsulinemia in diet-induced obese mice PMID: 17971513
Double incretin receptor knockout mice exhibit enhanced insulin action compared with wild-type mice when fed a regular diet and are protected from high-fat diet-induced obesity and insulin resistance. PMID: 17977951
Gastric inhibitory peptide receptor interacts with estrogens in the hypothalamic regulation of food intake in mice. PMID: 18505834
Results suggest that activation of the gastric inhibitory polypeptide receptor can improve diabetes control in high-fat-fed mice. PMID: 19073224
Analyses with GIPR-deficient mice suggest a role of GIP/GIPR signal transduction in promoting spontaneous recovery after nerve crush; injury of GIPR-deficient mouse sciatic nerve revealed impaired axonal regeneration. PMID: 19170165
Report differential importance of glucose-dependent insulinotropic polypeptide vs glucagon-like peptide 1 receptor signaling for beta cell survival in mice. PMID: 19766644

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Database Links

KEGG: mmu:381853

STRING: 10090.ENSMUSP00000092384

UniGene: Mm.333633

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-MP009438MO1
MSDS	MSDS
Size	$396
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO)， the EC₅₀ is 8.622-11.36 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage