| Code | CSB-EP866314HU1 |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
A cDNA ORF corresponding to the peptide of Human Angiopoietin-related protein 4 (ANGPTL4) was expressed with an N-terminal GST-tag in E.coli. ANGPTL4 CSB-EP866314HU1 is a truncated molecule having amino acid residues of Val28-Glu403. Its purity is greater than 90% as measured by SDS-PAGE. A molecular mass band of 88 about kDa was presented on the SDS-PAGE gel under reducing conditions. It was also validated by the LC-MS/MS analysis. This recombinant ANGPTL4 protein may be not only used for specific antibody production but also applied in the studies of cardiovascular diseases. ANGPTL4 is a secreted protein with multiple functions. It participates in various biological processes, such as lipid metabolism, angiogenesis, and vascular permeability, cell differentiation, glucose, and energy homeostasis, wound healing, inflammation, redox regulation, and tumorigenesis. The ANGPTL4-high expression has demonstrated to be related to poor prognostic outcome in patients with various solid tumors. This may suggest the involvement of ANGPTL4 in cancer onset and progression, metastasis, and anoikis resistance. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | ANGPTL4 |
| Uniprot No. | Q9BY76 |
| Research Area | Cardiovascular |
| Alternative Names | Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietin-like protein 4; Angiopoietin-related protein 4; ANGL4_HUMAN; ANGPT L2; ANGPT L4; ANGPTL2; Angptl4; ARP4; Fasting induced adipose factor; FIAF; HARP; Hepatic angiopoietin related protein; Hepatic fibrinogen/angiopoietin related protein; Hepatic fibrinogen/angiopoietin-related protein; HFARP; NL2; Peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin related protein; PGAR; pp1158; PPARG angiopoietin related protein; PSEC0166; TGQTL; UNQ171; Weakly similar to angiopoietin 1 [H.sapiens] |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 28-403aa |
| Target Protein Sequence | VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 69.6kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal GST-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis.; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
|
| Gene References into Functions |
|
| Subcellular Location | Secreted. Secreted, extracellular space, extracellular matrix. |
| Tissue Specificity | Detected in blood plasma (at protein level). Detected in liver. Detected in white fat tissue and placenta. Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney. |
| Database Links |
HGNC: 16039 OMIM: 605910 KEGG: hsa:51129 STRING: 9606.ENSP00000301455 UniGene: Hs.9613 |
