Recombinant Human Angiopoietin-related protein 4 (ANGPTL4), partial

In Stock
Code CSB-EP866314HU1
Abbreviation Recombinant Human ANGPTL4 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP101444h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ANGPTL4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP101444h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ANGPTL4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietin-like protein 4; Angiopoietin-related protein 4; ANGL4_HUMAN; ANGPT L2; ANGPT L4; ANGPTL2; Angptl4; ARP4; Fasting induced adipose factor; FIAF; HARP; Hepatic angiopoietin related protein; Hepatic fibrinogen/angiopoietin related protein; Hepatic fibrinogen/angiopoietin-related protein; HFARP; NL2; Peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin related protein; PGAR; pp1158; PPARG angiopoietin related protein; PSEC0166; TGQTL; UNQ171; Weakly similar to angiopoietin 1 [H.sapiens]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-403aa
Target Protein Sequence
VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
69.6kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

A cDNA ORF corresponding to the peptide of Human Angiopoietin-related protein 4 (ANGPTL4) was expressed with an N-terminal GST-tag in E.coli. ANGPTL4 CSB-EP866314HU1 is a truncated molecule having amino acid residues of Val28-Glu403. Its purity is greater than 90% as measured by SDS-PAGE. A molecular mass band of 88 about kDa was presented on the SDS-PAGE gel under reducing conditions. It was also validated by the LC-MS/MS analysis. This recombinant ANGPTL4 protein may be not only used for specific antibody production but also applied in the studies of cardiovascular diseases.

ANGPTL4 is a secreted protein with multiple functions. It participates in various biological processes, such as lipid metabolism, angiogenesis, and vascular permeability, cell differentiation, glucose, and energy homeostasis, wound healing, inflammation, redox regulation, and tumorigenesis. The ANGPTL4-high expression has demonstrated to be related to poor prognostic outcome in patients with various solid tumors. This may suggest the involvement of ANGPTL4 in cancer onset and progression, metastasis, and anoikis resistance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis.; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Gene References into Functions
  1. Carriers of p.E40K, a variant that abolishes ANGPTL4 ability to inhibit lipoprotein lipase, have lower odds of T2D (odds ratio 0.89, 95% confidence interval 0.85-0.92, p = 6.3 x 10(-10)), lower fasting glucose, and greater insulin sensitivity. PMID: 29899519
  2. A relevant role of ANGPTL-4 in human obesity and its involvement in long-term body weight changes. PMID: 29536615
  3. Data indicate that the angiopoietin-like protein 4 (ANGPTL4)-mediated upregulation of tristetraprolin expression regulates the stability of chemokines in human colon epithelial cells. PMID: 28287161
  4. The data suggest that exercise-induced ANGPTL4 is secreted from the liver and driven by a glucagon-cAMP-PKA pathway in humans. These findings link the liver, insulin/glucagon, and lipid metabolism together. PMID: 29031727
  5. Study data support dual roles for ANGPTL4 in urothelial carcinoma progression, either as a tumor suppressor or oncogene, in response to microenvironmental context. PMID: 29035390
  6. ANGPTL4 levels are increased in both plasma and adipose tissues of subjects with hypertension. PMID: 29490644
  7. Low ANGPTL4 expression is associated with childhood obesity. PMID: 28733963
  8. SNP rs11672433, a high-frequency locus in the ANGPTL4 gene, does not influence the predisposition to brain arteriovenous malformation or its effect is too small to be detected in the present size sample set. PMID: 29221972
  9. Levels of ANGPTL4 in the circulation and HDLs were increased in type 2 diabetics altering lipid metabolism. PMID: 28645936
  10. High expression of ANGPTL4 is associated with drug resistance in prostate cancer. PMID: 28560449
  11. this study suggests that the presence of C allele of rs1044250 and G allele of rs2278236 in ANGPTL4 gene is associated with higher risk of moderate/severe proteinuria in renal transplant patients PMID: 27913276
  12. These results suggested that ANGPTL4 was essential for proliferation and metastasis of lung cancer cells. PMID: 27166634
  13. The mutant tumors exhibited impaired proliferation, anoikis resistance, and migratory capability and had reduced adenylate energy charge. Further investigations also revealed that cANGPTL4 regulated the expression of Glut2 PMID: 28641978
  14. Data indicate angiopoietin-like 4 (ANGPTL4) as a key player that coordinates an increase in cellular energy flux crucial for EMT via an ANGPTL4/14-3-3gamma signaling axis. PMID: 28745316
  15. The authors now show: (1) that ANGPTL4 inactivates LPL by catalyzing the unfolding of its hydrolase domain; (2) that binding to GPIHBP1 renders LPL largely refractory to this inhibition; and (3) that both the LU domain and the intrinsically disordered acidic domain of GPIHBP1 are required for this protective effect. PMID: 27929370
  16. One of the variants, rs116843064, is a damaging missense variant within the ANGPTL4 gene. PMID: 27036123
  17. reduced expression of one of the survival-associated transcripts, Angiopoietin-like 4, impairs growth of a gemcitabine-resistant pancreatic cancer cell line. PMID: 27282075
  18. Serum ANGPTL4 is elevated in coronary artery disease, but levels do not reflect severity of disease. PMID: 28795637
  19. identify ANGPTL4 as a Wnt signaling antagonist that binds to syndecans and forms a ternary complex with the Wnt co-receptor Lipoprotein receptor-related protein 6 PMID: 29017031
  20. results suggest that ANGPTL4 could contribute to the development of retinal neovascularization in sickle cell patients and could therefore be a therapeutic target for the treatment of PSR PMID: 28832635
  21. Data suggest that purified FLD (C-terminal fibrinogen-like domain) of ANGPTL4 is sufficient to stimulate lipolysis in primary adipocytes; increasing circulating FLD levels in mice not only induces white adipose tissue lipolysis in vivo but also reduces diet-induced obesity without affecting LPL (lipoprotein lipase) activity; increasing systemic FLD levels induces beige conversion in white adipose tissue. PMID: 28842503
  22. enhanced expression of angiopoietin-like 4 in rheumatoid arthritis may explain the occurrence of insulin resistance, cardiovascular risk, and joint destruction [review] PMID: 28004425
  23. Neither serum nor urine Angptl4 appear to be good biomarkers in minimal change disease. Elevated urinary Angptl4 in glomerular disease appears to reflect the degree of proteinuria rather than any specific disease. PMID: 28441404
  24. results reveal that liganded GR spatiotemporally controls ANGPTL4 transcription in a chromosomal context. PMID: 28056052
  25. analyzed samples from our previously published studies on ANGPL4 levels in patients on hemodialysis and patients with diabetes type 2. These samples did not show false positive reactions. The levels of ANGPTL4 were comparable to those detected previously PMID: 28107351
  26. Oleic acid enhances head and neck squamous cell carcinoma metastasis through the ANGPTL4/fibronectin/Rac1/Cdc42 and ANGPTL4/fibronectin/MMP-9 signaling axes. PMID: 27865799
  27. Cyclic stretching of tendon fibroblasts stimulated the expression and release of ANGPTL4 protein. PMID: 26670924
  28. ANGPTL4 is secreted by human forearm muscle in postprandial conditions after a high-saturated fatty acid meal. Plasma ANGPTL4 concentrations were not associated with in vivo skeletal muscle LPL activity after a high-saturated fatty acid meal. Dietary fat quality affects plasma ANGPTL4, but it remains to be elucidated whether this influences short-term skeletal muscle lipid handling. PMID: 27011113
  29. angiopoietin-like 4 plays an important role in the regulation of epidermal growth factor induced cancer metastasis PMID: 27797381
  30. Beyond rare-variant genetic association study determined rare hypertriglyceridemia causal ANGPTL4 variants based on high throughput sequencing. PMID: 26903168
  31. ANGPTL4 variants are associated with, not only lower fasting triglyceride levels, but also a decreased cardiovascular risk in type 2 diabetic Tunisian patients. So, T266M and E40K polymorphism predicts cardiovascular disease risk in type 2 diabetic Tunisian population. PMID: 27004807
  32. Increased ANGPTL4 expression is associated with uveal melanoma. PMID: 26761211
  33. This study showed that the tagged SNPs and high serum levels of ANGPTL4 are associated with large artery atherosclerotic stroke and the lipid characteristics. PMID: 26944173
  34. ANGPTL4 mRNA expressions and serum levels were significantly higher in high grade breast carcinoma. PMID: 26745120
  35. Knockdown of ANGPTL4 inhibits proliferation and promotes apoptosis in cervical cancer. PMID: 27053616
  36. ANGPTL4 levels were higher in both obese and non-obese PCOS patients compared to healthy controls. PMID: 26291814
  37. circulating ANGPTL4 levels are up-regulated in COPD patients, and have correlations with pulmonary function and systematic inflammation in COPD PMID: 26813452
  38. Collectively, our findings indicate that miR-134 may regulate lipid accumulation and proinfiammatory cytokine secretion in macrophages by targeting the ANGPTL4 gene. PMID: 26546816
  39. This study is the first to show that podocyte-secreted Angptl4 is upregulated in diabetic neuropathy and can be detected in urine. PMID: 25424436
  40. Data suggest that up-regulation of plasma levels of Angptl4 (angiopoietin-like 4 protein) and LPL (lipoprotein lipase) can be used as biomarkers specific to detecting the stage of diabetic cardiovascular complications. PMID: 25597500
  41. Hepatocellular carcinoma (HCC) tissues expressed significantly lower levels of ANGPTL4 mRNA than non-tumor tissues; copy number of ANGPTL4 gene in tumor tissues was significantly lower than in non-tumor tissues of HCC patients. Higher frequency of methylation of CpG sites of ANGPTL4 promoter was detected in tumor tissues compared to non-tumor tissues. PMID: 25148701
  42. results demonstrate ANGPTL4 contributes to OSCC metastasis by stimulating cell invasion. ANGPTL4 is potential therapeutic target for preventing cancer metastasis. PMID: 25060575
  43. Carriers of E40K and other inactivating mutations in ANGPTL4 had lower levels of triglycerides and a lower risk of coronary artery disease than did noncarriers. PMID: 26933753
  44. We found that carriers of loss-of-function mutations in ANGPTL4 had triglyceride levels that were lower than those among noncarriers; these mutations were also associated with protection from coronary artery disease. PMID: 26934567
  45. ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7. PMID: 26417691
  46. A1AT binds to FA, and it is this form of A1AT that induces Angptl4 and FABP4 expression via a PPAR-dependent pathway. PMID: 26363050
  47. High serum ANGPTL4 with circulating RANKL suggests that ANGPTL4 may represent a novel marker for bone destruction in rheumatoid arthritis. PMID: 25289668
  48. results suggest targeting both ANGPTL4 and VEGF may be necessary for effective treatment or prevention of PDR and provide the foundation for studies evaluating aqueous ANGPTL4 as a biomarker to help guide individualized therapy for diabetic eye disease PMID: 26039997
  49. plasma ANGPTL4 levels as well as ANGPTL4 variants significantly predict cardiovascular events independently of conventional cardiovascular risk factors PMID: 25463098
  50. ANGPTL4 can both bind and inactivate lipoprotein lipase (LPL) complexed to GPIHBP1 and inactivation of LPL by ANGPTL4 greatly reduces the affinity of LPL for GPIHBP1 PMID: 25809481

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space, extracellular matrix.
Tissue Specificity
Detected in blood plasma (at protein level). Detected in liver. Detected in white fat tissue and placenta. Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.
Database Links

HGNC: 16039

OMIM: 605910

KEGG: hsa:51129

STRING: 9606.ENSP00000301455

UniGene: Hs.9613

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*