Recombinant Human Arginase-1(ARG1)

Code CSB-EP002005HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ARG1
Uniprot No. P05089
Research Area Signal Transduction
Alternative Names A I; Al; ARG 1; arg1; ARGI1_HUMAN; Arginase 1; Arginase liver; Arginase type I; Arginase; liver; Arginase-1; Arginase1; Liver type arginase; Liver-type arginase; Type I arginase
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-322aa
Target Protein Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 61.7kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
Gene References into Functions
  1. study of the significance of heat activation and the role of metal ions in human arginase PMID: 30282613
  2. TGF-beta1 and arginase-1 may play important roles in determining long-term graft survival. PMID: 30074212
  3. These results showed that arginase controlled sFlt-1 elevation to some extent. PMID: 29548823
  4. ARG1 gene polymorphisms and their association in individuals with essential hypertension in Pakistan has been presented. PMID: 29756997
  5. A subset of well-differentiated hepatocellular carcinomas are arginase-1 negative. PMID: 28970136
  6. The data in this study suggest that arginase I inhibition potentially represents a novel therapeutic target for the prevention and/or treatment of bronchopulmonary dysplasia-associated pulmonary hypertension. PMID: 27895230
  7. this study shows that infiltrating macrophages expressing Arg1 are present in active allergic contact dermatitis lesions PMID: 28747341
  8. High arginase expression is associated with glioblastoma. PMID: 27006175
  9. Report the value of Arg-1 in distinguishing HepPar-1-positive prostatic carcinoma from hepatocellular carcinoma at metastatic sites or cases of liver metastasis from prostate carcinoma. PMID: 27184483
  10. AEG-1 is positively activated in the tumorigenesis and deterioration of NSCLC. PMID: 28152520
  11. Arginase-1 expression is common (62.5%) in hepatoid adenocarcinoma and hence it is not useful in distinguishing hepatocellular carcinoma from hepatoid adenocarcinoma. PMID: 27137985
  12. Arginase 1 was highly expressed by tumor-associated Gr1+ microglia and macrophages. PMID: 27936099
  13. The authors report here that Candida albicans blocks nitric oxide production in human-monocyte-derived macrophages by induction of host arginase activity. PMID: 28119468
  14. Evidence for a negative association of arginase I with job strain and positive association with job control and social support in females. PMID: 28403218
  15. Two argininemia patients were initially diagnosed by tandem mass spectrometry in newborn screening. Mutation analysis of the ARG1 gene was performed by direct sequencing.Two missense mutations, p.D100N and p.R71T, in Patient-1 were predicted to lower the stability of arginase Iota by analysis of 3D crystal structure, while two nonsense mutations, p.G12X and p.E42X, in Patient-2 were predicted to lead to truncated protein. PMID: 28089752
  16. The results of this study suggested a novel relationship exists between ARG1, neutrophil-lymphocyte ratio , and stroke severity which may help guide future mechanistic studies of post-stroke immune suppression. PMID: 26515089
  17. This study provides a molecular mechanism of the pathogenesis of systemic lupus erythematosus by demonstrating an Arg-1-dependent effect of myeloid-derived suppressor cells in the development of TH17 cell-associated autoimmunity. PMID: 27009269
  18. ARG1 rs2781659 AA and rs2781667 TT genotypes were associated with lower IIEF scores (increased severity) in clinical erectile dysfunction (ED), whereas ARG1 GTCC haplotype is associated with higher IIEF scores in clinical ED, thus suggesting a genetic contribution of ARG1 variations to ED PMID: 26537638
  19. These results showed that alterations in the expression levels of Arg I and iNOS in the peripheral T cells and peripheral nodes of HIV infected patients are associated with disease progression in these patients. PMID: 26647762
  20. Increased ARG1 expression in macrophages after a single radiotherapy dose is an independent prognostic factor of skin toxicities. PMID: 26061397
  21. Arginase inhibition arrests human pulmonary artery smooth muscle cells in the G1/G0-phase under hypoxic conditions. PMID: 26126810
  22. Arginase from neutrophils can modulate nitric oxide production from activated macrophages which may affect the course of infection by intracellular bacteria. PMID: 26119192
  23. Overexpression and elevated activity of arginase I are involved in tobacco-induced pulmonary endothelial dysfunction. PMID: 25889611
  24. This method not only solved the problem of obtaining a large amount of arginase, but also provided a promising alternative for the future industrial production of L-Orn. PMID: 26227111
  25. the combination of high levels of CD14, FOXP3, and ARG1 mRNAs identified a small group of patients with excellent event-free and overall survival. PMID: 26161395
  26. Overexpression of Arg1 in the CNS of transgenic mice significantly reduced tau pathology. PMID: 26538654
  27. data indicate that helminth coinfection induces arginase-1-expressing type 2 granulomas, thereby increasing inflammation and TB disease severity. PMID: 26571397
  28. The data exclude a prognostic role of IL-10 and ARG-1 in metastatic neuroblastoma. PMID: 25961062
  29. Arginase activity increases in peripheral blood of patients with intestinal schistosomiasis. PMID: 25786588
  30. Data indicate that arginase-1 showed positivity in 2 ampullary region carcinomas and diffuse positivity in 1 duodenal adenocarcinoma. PMID: 26030248
  31. Arg1 induced accumulation of autophagosomes in MDA-MB-231 cells. PMID: 25501824
  32. Arg1 and PD-L1 are dynamically modulated upon neutrophil migration into human airways, and, Arg1, but not PD-L1, contributes to early neutrophil-driven T cell suppression in cystic fibrosis, likely hampering resolution of infection and inflammation. PMID: 25926674
  33. These results suggest that ARG1 and GABA influence both neural development and neuroblastoma and that benzodiazepines in clinical use may have potential applications for neuroblastoma therapy. PMID: 25437558
  34. Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model. PMID: 25205225
  35. rs2781666 may be associated with protection against pulmonary hypertension in preterm neonates with bronchopulmonary dysplasia PMID: 24919409
  36. The plasma levels of arginase I was higher in patients with DCL. PMID: 25124926
  37. Novel variants in the ARG1 locus associated with CRP levels in cardiovascular disease in a Korean population. [Meta-analysis] PMID: 24763700
  38. Arginase I levels are decreased in the plasma of pediatric patients with atopic dermatitis. PMID: 25027824
  39. Arginase activity was higher in cord blood of gestational diabetes mellitus mothers as opposed to the control group. PMID: 24376824
  40. Our results suggest that serum ARG and CRP together can efficiently diagnose Head and neck squamous cell carcinoma. PMID: 24715304
  41. Serum arginase I might regulate serum L-arginine and 3-nitrotyrosine via L-arginine. PMID: 24060156
  42. The independent associations of arginase I with urinary 8-OHdG and serum insulin may reflect its involvement in oxidative stress and diabetes mellitus. PMID: 24005081
  43. Arginase-1 mRNA expression correlates with myeloid-derived suppressor cell levels in peripheral blood of NSCLC patients. PMID: 23850196
  44. Both arginase-1 and HepPar-1 are effective markers of hepatocellular differentiation PMID: 24281232
  45. This study demonistrated that Five novel mutations in ARG1 gene in Chinese patients of argininemia. PMID: 23859858
  46. Glypican 3 and arginase-1 are the most reliable markers for identifying scirrhous hepatocellular carcinoma. PMID: 23348905
  47. Enzymes that are directly involved in the formation of urea are expressed in ocular tissues. PMID: 23740519
  48. Results show that the positively charged state of arginine is stable in the active site of arginase I, with that stabilization facilitated by the presence of hydroxide. PMID: 23327293
  49. The tumor suppressive function of arginase-I in both infiltrating and circulating myeloid-derived suppressor cells is a downstream target of activated STAT3. PMID: 23454751
  50. results suggest that Arg-1 may play a tumor suppressive role in HCC and could be a new, promising prognostic biomarker for HCC patients PMID: 23505904
  51. Combined use of arginase-1 and HepPar-1 can provide a potentially promising tool to improve the accuracy in distinguishing hepatocellular carcinoma from metastatic carcinoma and cholangiocarcinoma. PMID: 23111165
  52. In this study, the expression of Arg1 in granulomas of human lung tissues from patients with tuberculosis was investigated; Arg1 is expressed not only in granuloma-associated macrophages, but also in type II pneumocytes. PMID: 22827286
  53. we establish the following trend for turnover number (k(cat)) and catalytic efficiency (k(cat)/K(M)): Mn(2+) > Ni(2+) approximately Co(2+) >> Zn(2+). Therefore, Mn(2+) is required for optimal catalysis by human arginase I. PMID: 23061982
  54. Arginase I mediates pneumolysin induced pulmonary endothelial cell permeability. PMID: 22582175
  55. Three previously reported mutations were found (p.R21X; p.I11T and p.W122X), and five novel mutations were identified (p.G27D; p.G74V; p.T134I; p.R308Q; p.I174fs179). PMID: 22959135
  56. X-ray crystal structures are now reported of the complexes of Mn(2)(2+)-human arginase I (HAI) and Co(2)(2+)-HAI with L-2-amino-3-guanidinopropionic acid an amino acid bearing a guanidinium side chain two methylene groups shorter than that of L-arginine PMID: 22869115
  57. Loss of Arginase-1 is associated with metastasis in hepatocellular carcinoma. PMID: 22298472
  58. In the expression study, only ARG1 (4.5-fold) and VLDLR (4-fold) expressions were significantly upregulated in the overweight group compared with the normal-weight group. PMID: 22189190
  59. Induced arginase I after myocardial infarction may deplete the arginine pool. The changes related to arginine metabolism may have a role in ventricular dysfunction. PMID: 21704615
  60. (His)(6)-tagged rhARG1 was purified in one step from the Saccharomyces cerevisiae cell-free extract of the recombinant strain by metal-affinity chromatography with Ni-NTA agarose. PMID: 21945700
  61. Case Report: report blood/CSF amino acid levels in an infant with arginase1 deficiency, who presented unusually early with hyperammonaemia. PMID: 19052914
  62. s-nitrosation of arginase 1 requires direct interaction with inducible nitric oxide synthase PMID: 21533769
  63. The X-ray crystal structures of cobalt-reconstituted arginase I are reported, as well as its complexes with a boronic acid substrate analogue as well as the catalytic product. PMID: 21870783
  64. High arginase 1 is associated with rheumatoid arthritis. PMID: 21330347
  65. Serum arginase I is associated with oxidative stress in a healthy population and may become a new biomarker for early prediction of diabetes mellitus and other oxidative stress-related diseases. PMID: 20942574
  66. There was a distinct upregulation of arginase 1 in coronary arterioles of patients with type 1 or 2 dibetes mellitus, which contributes to a reduced NO production and consequently diminished vasodilation. PMID: 21217072
  67. Data report a true apo crystal form of human arginase which is suitable for small-molecule soaking. PMID: 21206033
  68. single nucleotide polymorphisms in the arginase 1 (ARG1) gene, which are associated with beta-agonist bronchodilator response PMID: 20851928
  69. androgen-regulated immunosuppressive pathway in human PCa through the expression of ARG1, ARG2 and IL-8 PMID: 20711410
  70. Extracellular activation of arginase-1 decreases enterocyte inducible nitric oxide synthase activity during systemic inflammation. PMID: 19713467
  71. Arg-1 is a sensitive and specific marker of hepatocytes and, as such, can be used to distinguish hepatocellular carcinomas from metastatic tumors in the liver. PMID: 20661013
  72. Loss of arginase is associated with allergic pulmonary inflammation. PMID: 20200399
  73. Association of ARG1 gene polymorphism is present in adult asthma, has lower reversibility specific with beta2 agonists. It is also associated with asthma severity, severe airway hyperresponsiveness, and less long-term response to inhaled corticosteroids. PMID: 20124949
  74. Human arginase I is a binuclear manganese metalloenzyme that catalyzes the hydrolysis of L-arginine to generate L-ornithine and urea. PMID: 20153713
  75. This review discusses the two arginase isoforms expressed in mammals: arginase I (cytosolic) and arginase II (mitochondrial), products of distinct genes located on different chromosomes and regulated independently. PMID: 19508396
  76. Increased capacity to upregulate arginase in younger individuals results in a more permissive environment for parasite growth, increased disease severity and pathology. PMID: 18478052
  77. Embryonic stem cell arginase I activity plays a role in the attenuation of maternal T cell activation in the embryo's microenvironment. PMID: 20032293
  78. Increased arginase expression in preeclampsia can induce uncoupling of NOS as a source of superoxide in the maternal vasculature in preeclampsia. PMID: 19684035
  79. ARG1 mutation is expected to result in complete loss-of-function of the arginase enzyme and therefore is the mostly likely cause of argininemia in this family PMID: 19936428
  80. Arginase AI activity and its mRNA level were significantly decreased in cirrhotic liver, whereas the activity and expression of arginase AII were concurrently raised, as compared to normal liver. PMID: 19636440
  81. crystal structure: arginase-boronic acid complex highlights a physiological role in erectile function PMID: 10542097
  82. Anti-CYP2D6 antibodies detected by quantitative radioligand assay and relation to antibodies to liver-specific arginase in patients with autoimmune hepatitis. PMID: 11750286
  83. gene expression in erythrocytes PMID: 12083807
  84. Overexpression of arginase is associated with colorectal carcinoma and colorectal liver metastasis PMID: 12115381
  85. the interaction of human liver arginase with tightly and weakly bound manganese ions by chemical modification and site-directed mutagenesis, weakly bound metal ion is needed only for conversion of active species PMID: 12139964
  86. Lung tissue from patients with IPF showed increased expression of arginase I. These results suggest that virus-induced upregulation of arginase I could be a mechanism driving lung fibrogenesis. PMID: 16709958
  87. Differentiation of cytotrophoblasts into syncytiotrophoblasts may be associated with l-arginine metabolism through modulation of l-arginine availability for eNOS and A-I. PMID: 16720041
  88. The results showed that flotillin-1 can interact with arginase1, and hence arginase activity was up-regulated by 26.8%. PMID: 17113085
  89. activated neutrophils coreleased ARG1 and gelatinase to the extracellular environment PMID: 17119118
  90. prostaglandin E(2) produced by the tumor induces arginase I expression in myeloid-derived suppressor cells [review] PMID: 17255300
  91. Arginase is up-regulated with hypertension. PMID: 17347269
  92. ARG1 polymorphizm is consistently associated with myocardial infarct and an increased common carotid intima media thickness. PMID: 17369504
  93. Crystal structure of human arginase I PMID: 17469833
  94. Arginase-1 is expressed and functionally important for collagen deposition in lung fibroblasts. PMID: 17934065
  95. ARG1 (arginase 1) is a novel gene for acute brochodilator response in both children and adults with asthma. PMID: 18617639
  96. The S-shaped motif of Arg1 is suggested as essential for the cooperative response of the enzyme to l-arginine at pH 7.5. PMID: 18957279
  97. Preoperative L-arginine concentration in the patient groups was 2-fold higher, whereas arginase activity was over 3- and 6-fold higher in colorectal cancer and colorectal cancer liver metastasis when compared with control. PMID: 19101531
  98. Over-expression of arginase I is associated with hepatocarcinogenesis. PMID: 19253371
  99. ARG1 and ARG2 loci are associated with childhood asthma. The association between ARG1 variation and asthma might depend on atopy and ambient ozone levels. PMID: 19281908
  100. Increase in arginase activity is associated with carcinoma of the gallbladder. PMID: 19282757

Show More

Hide All

Involvement in disease Argininemia (ARGIN)
Subcellular Location Cytoplasm, Cytoplasmic granule
Protein Families Arginase family
Tissue Specificity Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid c
Database Links

HGNC: 663

OMIM: 207800

KEGG: hsa:383

STRING: 9606.ENSP00000357066

UniGene: Hs.440934

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1