Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
A I; Al; ARG 1; arg1; ARGI1_HUMAN; Arginase 1; Arginase liver; Arginase type I; Arginase; liver; Arginase-1; Arginase1; Liver type arginase; Liver-type arginase; Type I arginase
Species
Homo sapiens (Human)
Expression Region
1-322aa
Target Protein Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Entire Human Arginase-1/ARG1 cDNA (1-322aa) with an N-terminal GST-tag was expressed in E.coli. The forming protein is the Recombinant full-length Human ARG1 protein. The purity of this protein is greater than 90% as determined by SDS-PAGE. Under reducing conditions, the SDS-PAGE gel showed a molecular weight band of about 62 kDa. This recombinant ARG1 protein may be used for specific antibody production or in the studies of ARG-1-related signal transduction.
ARG1 is the last enzyme in the urea cycle and it promotes the conversion of arginine to urea and ornithine. Deficiency of ARG1 causes hyperargininemia/arginase deficiency, an autosomal recessive urea cycle disorder, in which the increased arginine levels result in toxicity. High ARG1 expression has been found in several cancers, such as breast cancer and colorectal cancer. Malgorzata Czystowska-Kuzmicz etc. demonstrated that ARG1 is expressed in ovarian tumors and facilitates ovarian carcinomas (OvCa). The levels of ARG-1 is related to poor prognosis. ARG1 is carried by OvCa-derived small extracellular vesicles (EVs). EVs carrying ARG1 contribute to systemic immune suppression in OvCa patients and suppresses T-cell proliferation in vitro.
