Code | CSB-MP773799HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant human B- and T-lymphocyte attenuator (BTLA) was produced in mammalian cells. The DNA fragment used to prepare the recombinant BTLA protein corresponds to amino acid 31-150 of the human BTLA protein containing a C-terminal hFc-Myc-tag. This BTLA protein is an active protein, whose bio-activity has been validated in a functional ELISA (bind to biotinylated human TNFRSF14 with the EC50 of 137.8-233.4 ng/ml). Its purity reaches up to 94%, determined by SDS-PAGE. Due to the glycosylation, this BTLA protein has an apparent molecular mass of 55 kDa on the gel while its predicted mass is 43.9 kDa. Its endotoxin is less than 1.0 EU/ug measured by the LAL method. It is available now. BTLA is an immunomodulatory molecule widely expressed on the surface of immune cells. Upon binding to its ligand HVEM, BTLA can influence various signaling pathways and negatively regulate the activation and proliferation of immune cells. It is implicated in the pathogenesis of many respiratory diseases, including airway inflammation, asthma, infection, and pneumonia. |
Purity | Greater than 94% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | ①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml. |
Target Names | BTLA |
Uniprot No. | Q7Z6A9 |
Research Area | Cancer |
Alternative Names | (B- and T-lymphocyte-associated protein)(CD272) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 31-150aa |
Target Protein Sequence | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
Mol. Weight | 43.9 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-Myc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database Links |
HGNC: 21087 OMIM: 607925 KEGG: hsa:151888 STRING: 9606.ENSP00000333919 UniGene: Hs.445162 |