Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.
Alternative Names
(B- and T-lymphocyte-associated protein)(CD272)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
31-150aa
Target Protein Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Tag Info
C-terminal hFc-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human B- and T-lymphocyte attenuator (BTLA) was produced in mammalian cells. The DNA fragment used to prepare the recombinant BTLA protein corresponds to amino acid 31-150 of the human BTLA protein containing a C-terminal hFc-Myc-tag. This BTLA protein is an active protein, whose bio-activity has been validated in a functional ELISA (bind to biotinylated human TNFRSF14 with the EC50 of 137.8-233.4 ng/ml). Its purity reaches up to 90%, determined by SDS-PAGE. Due to the glycosylation, this BTLA protein has an apparent molecular mass of 55 kDa on the gel while its predicted mass is 43.9 kDa. Its endotoxin is less than 1.0 EU/ug measured by the LAL method. It is available now.
BTLA is an immunomodulatory molecule widely expressed on the surface of immune cells. Upon binding to its ligand HVEM, BTLA can influence various signaling pathways and negatively regulate the activation and proliferation of immune cells. It is implicated in the pathogenesis of many respiratory diseases, including airway inflammation, asthma, infection, and pneumonia.