Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

In Stock
Code CSB-MP773799HU
Abbreviation Recombinant Human BTLA protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml. Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2μg/ml can bind Anti-BTLA recombinant antibody(CSB-RA773799MAIHU), the EC50 is 1.763-3.542 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
(B- and T-lymphocyte-associated protein)(CD272)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-150aa
Target Protein Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Mol. Weight
43.9 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

BTLA (CD272) functions as a coinhibitory receptor in the immune checkpoint network, engaging HVEM (TNFRSF14) to dampen T- and B-cell activation—making it a compelling target in immuno-oncology drug discovery. This recombinant human BTLA encompasses the extracellular ligand-binding domain (aa 31–150) with a C-terminal hFc1-Myc tag, and mammalian cell expression preserves the native folding and post-translational modifications critical for faithful receptor-ligand interaction. Functional ELISA confirms robust binding to biotinylated human TNFRSF14 with an EC50 of 137.8–233.4 ng/ml, providing validated support for ligand-binding assays, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the quality thresholds commonly required for SPR- or BLI-based affinity characterization, small-molecule inhibitor screening, and use as a positive control in checkpoint receptor binding assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.
Gene References into Functions
  1. Data suggest that both HVEM and UL144 bind a common epitope of BTLA, whether engaged in trans or in cis; these studies were conducted in cell lines representing B-lymphocytes, T-lymphocytes, and natural killer cells. (HVEM = human herpes virus entry mediator; UL144 = membrane glycoprotein UL144 of Human herpesvirus 5; BTLA = human B- and T-lymphocyte attenuator) PMID: 29061848
  2. our data suggested that the BTLA/HVEM pathway contributes to peripheral T cell suppression in hepatocellular carcinoma patients PMID: 30116751
  3. data provide the first evidence that increased BTLA predicts poor prognosis in patients with diffuse large B-cell lymphoma (DLBCL), and blockade of BTLA with other checkpoints may potentially represent a new strategy for immunotherapy of DLBCL. PMID: 29353075
  4. The genetic variants of rs76844316 in BTLA influence the susceptibility to severe chronic hepatitis B and might play a protective role against the progression of chronic hepatitis B. PMID: 29558758
  5. The impairment of Bregs and CD19+/BTLA+ cells could play an important pathogenic role in multiple sclerosis (MS). PMID: 27412504
  6. Our data portrays BTLA as a molecule with the singular ability to provide both costimulatory and coinhibitory signals to activated CD8(+) T cells, resulting in extended survival, improved tumor control, and the development of a functional recall response. PMID: 28754817
  7. results indicate that polymorphisms rs1982809 situated in 3' UTR nearby region of BTLA gene might be considered as low-penetrating risk factor for RCC, but results have to be confirmed in further studies PMID: 27234378
  8. The percentage of circulating BTLA+CD4+ lymphocytes was significantly higher in patients with severe community acquired pneumonia. PMID: 28164546
  9. Plasma concentrations of soluble BTLA were increased early in sepsis/septic shock and correlated to severity of disease. A baseline concentration >21ng/mL was associated with a poor prognosis. PMID: 28056053
  10. this study shows that in chronic hepatitis B virus patients, a subset of inefficient interferon-gamma producing antigen-specific CD8+ T cells recruited to the liver expressed high BTLA levels PMID: 27743606
  11. this study shows that BTLA expression is likely associated with positive rather than conventional negative regulation of CD11c antigen-presenting cell stimulatory capacity PMID: 27717503
  12. rs1982809 BTLA gene polymorphism is associated with mRNA expression level and variations in the BTLA gene might be considered as potentially low-penetrating chronic lymphocytic leukemia risk factor PMID: 27933341
  13. Study showed a decreased expression of BTLA in ocular Behcet's disease suggesting that it may be involved in the development and recurrence of this disease. PMID: 26841832
  14. BTLA expression declines on B cells of the aged and is associated with low responsiveness to the trivalent influenza vaccine. PMID: 26277622
  15. our study confirms that CD200/BTLA deletions are recurrent genetic lesions in the biology of BCP-ALL PMID: 26137961
  16. Focal deletions of the BTLA were associated with B-cell precursor acute lymphoblastic leukemia. PMID: 25261097
  17. high BTLA expression levels in gastric cancer, identified by IHC, are an independent biomarker for the poor prognosis of patients with gastric cancer. PMID: 25334051
  18. Data indicate taht lung function and the expressions of B, T lymphocyte attenuator (BTLA) and Treg cells were lower in patients with rheumatism than those in normal controls. PMID: 24909289
  19. BTLA is a coreceptor that negatively regulates human Vgamma9Vdelta2 T-cell proliferation and has a role in immune escape for lymphoma cells PMID: 23692853
  20. BTLA and HVEM may have roles in graft rejection after kidney transplantation PMID: 23375291
  21. BTLA regulates human B cell responses and has implications for future development of therapies modulating B cells. PMID: 22903545
  22. The expression of BTLA has been observed on the surface of several kinds of cells within synovial tissues of RA patients, which indicates this signal might be involved in the regulation of local T cell activation and the pathogenesis of RA. PMID: 22691359
  23. These findings support role for BTLA and/or HVEM as potential, novel diagnostic markers of innate immune response/status and as therapeutic targets of sepsis. PMID: 22459947
  24. study described the expression and spatial distribution of HVEM and BTLA in rheumatoid arthritis synovial tissues, and results indicated that HVEM/BTLA may be involved in regulating the progress of joint inflammation PMID: 22179929
  25. BTLA-HVEM interactions impair minor histocompatibiility antigen-specific T cell functionality, providing a rationale for BTLA signaling blockade in post-stem cell transplantation. PMID: 22634623
  26. Added with PD-1 and Tim-3 blockades, BTLA blockade enhanced the expansion, proliferation, and cytokine production of NY-ESO-1-specific CD8(+) T cells. PMID: 22205715
  27. HVEM-BTLA cis complex provides intrinsic regulation in T cells serving as an interference mechanism silencing signals coming from the microenvironment. PMID: 21920726
  28. The results of a mutagenesis study of HVEM suggest that the CD160 binding region on HVEM was slightly different from, but overlapped with, the BTLA binding site. PMID: 21959263
  29. 590C single-nucleotide polymorphism of B- and T-lymphocyte attenuator was significantly associated with susceptibility to rheumatoid arthritis, but not to systemic lupus erythematosus or Sjogren's syndrome. PMID: 21403914
  30. BTLA expression on overall CD4(+) and CD8(+) T cells was progressively decreased in HIV-1 infection, which was directly correlated with disease progression and CD4(+) T-cell differentiation and activation PMID: 21592997
  31. In vitro blockade of the BTLA pathway augments allogeneic as well as cytomegalovirus-specific CD8-positive T cell proliferation, thereby enhancing the functional capacity of cytotoxic T lymphocytes in viral infections. PMID: 20693422
  32. BTLA gene polymorphisms may affect the sporadic breast cancer risk and prognosis in Chinese women in northeast of Heilongjiang Province PMID: 19585237
  33. Binding of HVEM to BTLA attenuates T cell activation, identifying HVEM/BTLA as a coinhibitory receptor pair. PMID: 15647361
  34. distinct herpesviruses target the HVEM-BTLA cosignaling pathway, suggesting the importance of this pathway in regulating T cell activation during host defenses. PMID: 16131544
  35. 2.8-A crystal structure of the BTLA-HVEM complex shows that BTLA binds the N-terminal cysteine-rich domain of HVEM and employs a unique binding surface PMID: 16169851
  36. BTLA is constitutively expressed on most CD4+ and CD8+ T cells and its expression progressively decreases upon T cell activation. PMID: 16643847
  37. Cross-linking of BTLA with mAb 7D7 suppressed T lymphocyte proliferation, downregulated the expression of T cell activation marker CD25, and inhibited the production of interferon (IFN)-gamma, interleukin (IL)-2, IL-4, and IL-10. PMID: 17257317
  38. BTLA is an inhibitory coreceptor of the B cell receptor (BCR) signaling pathway that attenuates B cell activation by targeting the downstream signaling molecules Syk and B cell linker protein (BLNK). PMID: 19155498
  39. this study did not find any genetic contribution of the BTLA gene to the development of T1D and SLE in Japanese population. PMID: 19207938
  40. results suggest that down-regulation of the BTLA-HVEM pathway may be involved in germinal center B-cell activation. PMID: 19762537
  41. the HVEM-BTLA cis-complex competitively inhibits HVEM activation by ligands expressed in the surrounding microenvironment, thus helping maintain T cells in the naive state. PMID: 19915044
  42. HVEM binds to B T lymphocyte attenuator (BTLA), an Ig family member, which inhibits T cell proliferation. PMID: 15568026

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 21087

OMIM: 607925

KEGG: hsa:151888

STRING: 9606.ENSP00000333919

UniGene: Hs.445162

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*