Recombinant Human Cancer/testis antigen 1(CTAG1A)

Code CSB-YP006125HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P78358
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Autoimmunogenic cancer/testis antigen NY-ESO-1Cancer/testis antigen 6.1 ;CT6.1L antigen family member 2 ;LAGE-2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Research Area Cancer
Source Yeast
Gene Names CTAG1A
Protein Names Recommended name: Cancer/testis antigen 1 Alternative name(s): Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1 Short name= CT6.1 L antigen family member 2 Short name= LAGE-2
Expression Region 1-180aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 20.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cytoplasm
Protein Families CTAG/PCC1 family
Tissue Specificity Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in
Database Links

HGNC: 24198

OMIM: 300156

KEGG: hsa:1485

STRING: 9606.ENSP00000332602

UniGene: Hs.534310

Related Products

CTAG1A Antibodies

CTAG1A Antibodies for Homo sapiens (Human)

CTAG1A Proteins

CTAG1A Proteins for Homo sapiens (Human)

CTAG1A ELISA Kit

CTAG1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.