Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1
Species
Homo sapiens (Human)
Expression Region
1-180aa
Target Protein Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
C-terminal hFc-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Just like other recombinant proteins, the production of this recombinant Human CTAG1A protein began with appropriate cDNA and PCR methods, and then the CTAG1A expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into Mammalian cell for the expression of the recombinant Human CTAG1A protein. C-terminal FC-Myc tag was used in the process. And we finally get the protein of interest with purity of 85%+.
CTAG1A (also called CTAG, CTAG1, ESO1, LAGE2, LAGE2A) is a gene encoding a protein called cancer/testis antigen 1 in human. The protein encoded by this gene is also known as autoimmunogenic cancer/testis antigen NY-ESO-1 (NY-ESO-1),cancer/testis antigen 6.1 (CT6.1) and L antigen family member 2 (LAGE-2). CTAG1A is an identical copy of the CTAG1B gene. The protein encoded by CTAG1A gene is one of the most immunogenic tumor antigens defined to date, because it induces spontaneous humoral and CD8+ T cell responses against NY-ESO-1 in 40%+ to 50%+ of patients with advanced NY-ESO-1–expressing tumors.