Recombinant Human Forkhead box protein M1 (FOxM1), partial

In Stock
Code CSB-EP008828HU
Abbreviation Recombinant Human FOXM1 protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
FKHL16; Forkhead box M1; Forkhead box protein M1; forkhead like 16; Forkhead-related protein FKHL16; FOX M1; Foxm1; FOXM1_HUMAN; FOXM1B; Hepatocyte nuclear factor 3 forkhead homolog 11; HFH-11; HFH11; HNF-3/fork-head homolog 11; HNF3; INS1; M phase phosphoprotein 2; M-phase phosphoprotein 2; MPHOSPH2; MPM-2 reactive phosphoprotein 2; MPP2; PIG29; TGT3; Transcription factor Trident; Trident; WIN; Winged-helix factor from INS-1 cells; Winged-helix factor from INS1 cells
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
235-327aa
Target Protein Sequence
ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.2kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Dive into the study of Forkhead box protein M1 (FOXM1), a crucial transcription factor implicated in cell cycle regulation and cell proliferation, with our Recombinant Human FOXM1 protein. FOXM1, encoded by the FOXM1 gene, is a key player in the regulation of various cellular processes, including DNA damage response, angiogenesis, and metastasis, making it an essential focus in cancer research.

Our Recombinant Human FOXM1 protein is expressed in an E.coli system and covers the 235-327aa region of the full-length protein. The N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag facilitate efficient protein purification and detection in your experimental setup. This high-quality, partial-length FOXM1 protein boasts a purity greater than 90%, as validated by SDS-PAGE, providing you with a dependable research tool. Choose between liquid or lyophilized powder forms according to your laboratory needs and streamline your research endeavors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Gene References into Functions
  1. The tumour suppressive roles of miR8765p overexpression in GBM cells were significantly reversed by FOXM1 reintroduction. PMID: 30365126
  2. Data show that forkhead box protein M1 (FoxM1) enhanced carboplatin resistance in Y-79CR cells through directly up-regulating the transcription of ATP-binding cassette transporter C4 (ABCC4). PMID: 30060118
  3. FoxM1 repression during human aging leads to mitotic decline and aneuploidy-driven full senescence. PMID: 30026603
  4. TBX2 is a neuroblastoma core regulatory circuitry component enhancing MYCN/FOXM1 reactivation of DREAM targets. PMID: 30451831
  5. Studies indicate that the oncogene forkhead box protein M1 (FoxM1) has emerged as an important molecule implicated in initiation, development and progression of cancer [Review]. PMID: 28855104
  6. These findings revealed the role of forkhead box M1 upregulation by manganese superoxide dismutase overexpression in maintaining lung cancer stem-like cell properties. Therefore, inhibition of forkhead box M1 upregulation by manganese superoxide dismutase overexpression may represent an effective therapeutic strategy for non-small cell lung cancer. PMID: 30111255
  7. FoxM1 silenced cell induces G2/M cell cycle arrest and necrosis. PMID: 29343703
  8. High FOXM1 expression is associated with invasion of renal cancer. PMID: 30066895
  9. Analyses with phospho-defective and phospho-mimetic mutants of FoxM1b identified a critical role of the Plk1 phosphorylation sites in regulating the binding of FoxM1b to Rb and DNMT3b. PMID: 28387346
  10. Study found that DLX1 was the direct target of FoxM1 in HCC. Downregulation of FoxM1 inhibits the proliferation, migration, and invasion of HCC cells by miR-214. PMID: 29973656
  11. A significant over expression of forkhead box protein M1 (FOXM1), polo-like kinase 1 (PLK1) and centrosomal protein 55 (CEP55) was observed in tumor samples compared to adjacent and normal bladder tissues, suggesting they may be potential candidate's biomarkers for early diagnosis and targets for cancer therapy. PMID: 30277841
  12. In conclusion, our findings indicated that FOXM1 was highly expressed in lung cancer cells after exposure to ionizing radiation (IR). We also found that FOXM1 promoted radioresistance, invasion, migration, and EMT of lung cancer cells after IR, partly through upregulating KIF20A. PMID: 29704495
  13. The concurrent overexpression of FoxM1 and FoxP3 was evident in gastric cancer and inversely correlated with patient survival. PMID: 29804142
  14. A better understanding of the mechanisms regulating the FOXO3-FOXM1 axis, as well as their downstream transcriptional targets and functions, may render these proteins reliable and early diagnostic/prognostic factors as well as crucial therapeutic targets for cancer treatment and importantly, for overcoming chemotherapeutic drug resistance. PMID: 29180117
  15. CRNDE overexpression accelerated lipopolysaccharide-induced apoptosis and inflammation via up-regulation of FOXM1 in WI-38 cells. PMID: 29864958
  16. In male breast cancer patients high forkhead box protein M1 (FOXM) expression is significantly associated with disease free survival (DFS). Median progression free survival under chemotherapy or Tamoxifen hormone therapy is shorter for the High FOXM1 expression group. High FOXM1 expression is significantly associated with chemotherapy and endocrine resistance. PMID: 29504520
  17. High FoxM1 expression is associated with the development of prostate cancer. PMID: 29554906
  18. FOXM1 promotes proliferation in human hepatocellular carcinoma cells by transcriptional activation of CCNB1. PMID: 29705704
  19. Upregulation of FOXM1 in a subset of relapsed myeloma results in poor outcome. PMID: 29449574
  20. We first reported that the FOMX1 pathway is the most upregulated and the PPARalpha pathway is the most downregulated pathway in Triple Negative Breast Cancers (TNBCs). These two pathways could be simultaneously targeted in further studies. Also the pathway classifier we performed in this study provided insight into the TNBC heterogeneity. PMID: 29301506
  21. FOXM1 and ABCG2 may be useful targets and important parameters in the treatment of bladder cancer. PMID: 29397866
  22. FOXM1 is a highly prognostic marker for disease progression. PMID: 29959570
  23. Study found that FOXM1 is a target of miR-149. miR-149 inhibited FOXM1 mRNA and protein expression levels by binding to its 3'-UTR in non-small cell lung cancer (NSCLC) cells. Moreover, patients with low expression levels of miR-149 exerted high FOXM1 mRNA levels. PMID: 29130108
  24. we found that FOXM1 inhibitor attenuated tumorigenesis and radioresistance of glioblastoma (GBM) both in vitro and in vivo. Altogether, BUB1B promotes tumor proliferation and induces radioresistance in GBM, indicating that BUB1B could be a potential therapeutic target for GBM. PMID: 29039578
  25. MYBL2 is a key downstream factor of Akt/FoxM1 signaling to promote progression of human glioma, and could be a new candidate gene for molecular targeting therapy and biomarker for radiotherapy of glioma. PMID: 28784180
  26. FoxM1 may enhance the invasion and migration of cancer cells, and thus promotes their Epithelialmesenchymal transition, in a mechanism that may involve the regulation of Snai1. PMID: 28849004
  27. FoxM1 promotes glioma progression by enhancing UBE2C transcription PMID: 28767320
  28. We found that, compared with the control, the proliferative, migratory and invasive abilities of PC-3 cells were decreased after incubation with different concentrations of TMP . The expression of FOXM1 was decreased in TMP-treated PC-3 cells PMID: 28677763
  29. FOXM1 expression could be suppressed by miR-216b via direct binding to FOXM1 3'-UTR and miR-216b could inhibit cell proliferation by regulating FOXM1 related Wnt/beta-catenin signal pathway. MiR-216b level is related to prognosis in cervical cancer patients and may serve as a potential prognostic marker. PMID: 28978307
  30. Results revealed that FoxM1 protein was highly expressed in HSCC tissues and that its high expression was closely associated with HSCC tumor differentiation (P=0.004), tumor size (P=0.002), clinical stage (P=0.001), lymph node metastasis (P=0.002), treatment (P=0.045) and expression of the proliferation marker Ki-67 (P<0.001). PMID: 28848994
  31. Findings suggest that FoxM1 promotes the EMT, invasion and migration of TSCC cells, and cross-talks with c-Met/AKT signaling to form a positive feedback loop to promote TSCC development. PMID: 29360662
  32. The suppressive activity of miR216b in glioma, which is largely ascribed to downregulation of FoxM1. PMID: 28731180
  33. our study provide convincing evidences that FoxM1-regulated PBK exerts oncogenic activities towards HCC via the activation of beta-Catenin pathway. PMID: 28525379
  34. Here we demonstrated that FOXM1 was differentially expressed between MIBC subtypes concordant to its subtype specific expression in breast cancer. PMID: 28498805
  35. Results demonstrated that miR-216b is a tumor suppressor in melanoma, identified the FOXM1 signaling pathway as a target of miR-216b action. PMID: 28225180
  36. Authors showed that RFC5 expression is positively correlated with FoxM1 expression in human glioma cells and FoxM1 is able to transcriptionally activate RFC expression by interaction with the RFC5 promoter. PMID: 28185110
  37. NF-kappaB physically interacts with FOXM1 and promotes transcription of FOXM1 gene. NF-kappaB directly binds FOXM1 gene promoter. Silencing p65 attenuates FOXM1 and beta-catenin expression. NF-kappaB activation is required for nuclear translocation of FOXM1 and beta-catenin. FOXM1 and beta-catenin positively regulate NF-kappaB.Knockdown of beta-catenin and FOXM1 downregulates p65 protein and NF-kappaB-dependent reporte... PMID: 27492973
  38. FOXM1 expression in solid tumor tissues is associated with poor survival in most solid tumors, which suggests that FOXM1 is a valuable prognostic biomarker and a promising therapeutic target for solid tumors. PMID: 28427178
  39. FOXM1 is up-regulated in all three major EOCs subtypes, and is a prognostic biomarker and a potential combinatorial therapeutic target in platinum resistant disease, irrespective of tumor histology. PMID: 28482906
  40. Authors demonstrated that inhibition of either FOXM1 or AGR2 in human PIMAs inhibited mucinous characteristics, and reduced tumor growth and invasion. FOXM1 is necessary and sufficient to induce mucinous phenotypes in lung tumor cells in vivo. PMID: 29267283
  41. we hypothesize that FOXM1 regulates radioresistance via STAT3 in GBM cells. We also, show GBM patients with high FOXM1 expression have poor prognosis. PMID: 27764801
  42. FOXM1 promotes 5-FU resistance by up-regulating ABCC10 expression in colorectal tumor cells. PMID: 28051999
  43. Findings provide a novel understanding of the mechanism of gastric cancer and highlight the important role of BTF3/FOXM1 in tumor growth and BTF3/JAK2/STAT3 in EMT and metastasis PMID: 28276310
  44. FOXM1 bound directly to the GLUT1 and HK2 promoter regions and regulated the promoter activities and the expression of the genes at the transcriptional level. This reveals a novel mechanism by which glucose metabolism is regulated by FOXM1. PMID: 27351131
  45. Gli1 promotes colorectal cancer cells metastasis in a Foxm1-dependent manner by activating EMT and PI3K-AKT signaling. PMID: 27863385
  46. we suggest that high glucose and elevated O-GlcNAcylation stabilize FOXM1 protein by its reduced degradation via GSK-3beta inactivation in MKN45 cells, suggesting that the higher risk of gastric cancer in diabetic patients could be partially due to O-GlcNAcylation-mediated FOXM1 stabilization PMID: 29196265
  47. Our study suggests that FOXM1 transcription factor regulates Integrin b1 gene expression and that FOXM1/ Integrin-b1/FAK axis may play an important role in the progression of Triple-negative breast cancer PMID: 28361350
  48. Targeting FOXM1 with thiostrepton decreased FOXM1 mRNA expression and its downstream targets such as CCNB1 and CDC25B, leading to cell death in both cell lines and patients' ascites cancer cells. PMID: 28692634
  49. these results demonstrate that the reversible acetylation of FOXM1 by p300/CBP and SIRT1 modulates its transactivation function PMID: 27542221
  50. this study shows that FOXM1 confers resistance to gefitinib in lung adenocarcinoma via a MET/AKT-dependent positive feedback loop PMID: 27494877

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not e
Database Links

HGNC: 3818

OMIM: 602341

KEGG: hsa:2305

STRING: 9606.ENSP00000342307

UniGene: Hs.239

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*