Recombinant Human Protein deacetylase HDAC6 (HDAC6), partial

In Stock
Code CSB-EP010242HU
Abbreviation Recombinant Human HDAC6 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
CPBHM; FLJ16239; HD 6; HD6; HDAC 6; HDAC6; HDAC6_HUMAN; Histone deacetylase 6 (HD6); Histone deacetylase 6; JM 21; JM21; KIAA0901; OTTHUMP00000032398; OTTHUMP00000197663; PPP1R90; Protein phosphatase 1 regulatory subunit 90
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-488aa
Target Protein Sequence
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
70.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Explore the world of epigenetics and nuclear signaling with our Recombinant Human HDAC6, a highly specific histone deacetylase 6 known for its roles in chromatin remodeling, gene expression regulation, and cellular processes. As a key player in these vital mechanisms, HDAC6 is an invaluable protein for researchers seeking to elucidate the complex networks governing cell function and regulation.

Our Recombinant Human HDAC6 protein is expressed in an E. coli system, providing a partial protein sequence (1-488 amino acids). The N-terminal 6xHis-SUMO-tag allows for efficient purification and detection in a variety of experimental contexts. With a purity greater than 90% as determined by SDS-PAGE, this recombinant protein ensures consistent results and excellent performance in your research. The product is available in both liquid and lyophilized powder forms to accommodate your specific experimental requirements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. In addition to histones, deacetylates other proteins: plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin. Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Gene References into Functions
  1. In this review, we describe the HDACs, their inhibitors, and the recent advances of HDAC6 inhibitors, their mechanisms of action and role in lymphoproliferative disorders. PMID: 30096875
  2. Mycobacterium tuberculosis infection disturbs the HDAC6/HDAC11 levels to induce IL-10 expression in macrophages. PMID: 29523311
  3. Histone deacetylase 6 (HDAC6) inhibition enhanced glioma stem cells (GSCs) radiosensitivity via inactivating sonic hedgehog protein (SHH)/glioma-associated oncogene homolog 1 (Gli1) pathway. PMID: 29222038
  4. Cortactin (CTTN) silencing in megakaryocyte (MK) phenocopies histone deacetylase 6 (HDAC6) inactivation and knockdown leads to a strong proplatelet formation (PPF) defect. PMID: 29176689
  5. Hdac5 and Hdac6 expression are required for the adequate expression of Icer and adipocyte function. Altered adipose expression of the two Hdacs in obesity by hypoxia may contribute to the development of metabolic abnormalities. PMID: 27900262
  6. this study reports that HDAC6 is involved in reactive oxygen species-NF-kappaB signaling pathway related to pro-inflammatory cytokine expression PMID: 29414656
  7. DTBP represents a promising lead structure for the development of HDAC6 inhibitors, with an improvement in specificity conferred by modification of the cap group. We propose for the first time that the underlying mechanism of the anticancer activity of DTBP is attributed to inhibition of HDAC6 activity. PMID: 29427610
  8. To the best of our knowledge, this is the first report of an HDAC6 selective inhibitor bearing a hydrazide ZBG. Its capability to passively cross the blood-brain barrier (BBB), as observed through PAMPA assays, and its low cytotoxicity in vitro, suggested its potential for drug development. PMID: 27404291
  9. we observed an homologous-recombination deficiency (HRD)-associated level of HDAC6 overexpression, which supports a potential role for the effectiveness of HDAC inhibitor treatment in HRD tumors that are characterized by low levels of H4 lysine acetylation. PMID: 28866885
  10. High expression of HDAC6 is associated with chondrosarcoma. PMID: 28586053
  11. HDAC6, a primarily cytoplasmic deacetylase, mediates TGF-beta1-induced EMT in human lung cancer cells via activation of Notch1. PMID: 27499032
  12. Results confirm histone deacetylase 9 (HDAC9) as a major risk gene for large artery stroke with an association in the 3'-UTR. PMID: 28265093
  13. deletion or inhibition of the cytoplasmic shuttling factor HDAC6 suppressed neuritic tau bead formation in neurons. PMID: 28854366
  14. At the recommended phase II dose of ricolinostat of 160 mg daily, the combination with bortezomib and dexamethasone is safe, well-tolerated, and active, suggesting that selective inhibition of HDAC6 is a promising approach to multiple myeloma therapy. PMID: 28053023
  15. Increased HDAC6 expression is associated with renal cell carcinoma. PMID: 28128740
  16. Our work shows that RanBPM, together with the CTLH complex, associates with HDAC6 and restricts cell migration through inhibition of HDAC6 activity. This study uncovers a novel function for the CTLH complex and suggests that it could have a tumour suppressive role in restricting HDAC6 oncogenic properties. PMID: 28668087
  17. Results provide evidence that HDAC6 mediates the HIV-1 Tat-induced expression of chemokines by regulating reactive oxygen species-Nox2-based NADPH oxidase pathways in astrocytes. Furthermore, there is crosstalk between HDAC6 and NADPH oxidase in HIV-1 Tat-induced chemokine expression in astrocytes. PMID: 28499252
  18. The development of this ACY-1215-resistant cell line has provided valuable insights into the mechanistic role of HDAC6 in lymphoma and offered a novel method to identify rational synergistic drug combinations. PMID: 27993968
  19. rhTGF-beta1 affects sensitivity of human osteoblasts towards mechanical stimuli by damaging the microtubule structure of primary cilia in a HDAC6-dependent manner. PMID: 28271209
  20. In conclusion, HDAC6 might enhance aggressive melanoma cells progression via interacting with PTPN1, which was independent of its histone modifying activity. PMID: 29278704
  21. Using motor neurons derived from induced pluripotent stem cells from patients with amyotrophic lateral sclerosis and FUS mutations, axonal transport defects could be successfully rescued by HDAC6 inhibitors or silencing HDAC6. PMID: 29021520
  22. Data show that selective histone deacetylase 6 (HDAC6) inhibition or knockdown of HDAC6 expression was able to prevent caspase 3 activation in lung endothelial cells and maintain lung endothelial cell-cell junctions. PMID: 27419634
  23. The HDAC6 Inhibitor Tubacin Induces Release of CD133(+) Extracellular Vesicles From Cancer Cells. PMID: 28452069
  24. MicroRNA-22 Promoted Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting HDAC6 PMID: 28195408
  25. A decrease of HDAC6 expression caused by Helicobacter pylori infection is associated with oncogenic transformation in gastric cancer. PMID: 28700998
  26. these results suggest that HDAC1 and HDAC6 may play a role in clear cell renal cell carcinoma biology PMID: 27506904
  27. Genetic abrogation of HDAC6 in primary melanoma samples and cell lines, down-regulates the expression of PD-L1, an important co-stimulatory molecule expressed in cancer cells, which activates the inhibitory regulatory pathway PD-1 in T-cells. PMID: 26775640
  28. activation appears to be a key survival mechanism for HDAC6 inhibitor treatment. PMID: 27362804
  29. ARID1A mutation inactivates the apoptosis-promoting function of p53 by upregulating HDAC6, indicating that pharmacological inhibition of HDAC6 is a therapeutic strategy for ARID1A-mutated cancers. PMID: 28737768
  30. 7-amino-4-methylcoumarin did not affect acetyllysine preference in a multiply acetylated substrate. In contrast, AMC significantly enhanced KDAC6 substrate affinity, greatly reduced Sirt1 activity, eliminated the substrate sequence specificity of KDAC4, and had no consistent effect with KDAC8 substrates. PMID: 28749131
  31. deacetylation of MST1 mediated by HBXIP-enhanced HDAC6 results in MST1 degradation in a chaperone-mediated autophagy (CMA). manner in promotion of breast cancer growth. PMID: 26657153
  32. Suggest that HDAC4 and HDAC6 are guardians of irradiation-induced DNA damage and stemness, thus promoting radioresistance in glioblastoma cells. PMID: 28342984
  33. These results indicate overlapping and distinct functions of HDAC6 and SIRT2. PMID: 27311481
  34. Results provide evidence that HDAC6 could regulate HMGN2 acetylation levels and binding to Stat5a-responsive promoters, and therefore, Stat5a transcriptional activity in breast cancer cells. PMID: 27358110
  35. HDAC6 promotes glioblastoma cell proliferation and confers resistance to temozolomide. PMID: 27267806
  36. The authors characterized the histone deacetylase 6-interacting proteins in LNCaP metastatic prostate cancer cells and found that histone deacetylase 6 interacts with proteins involved in several cellular processes, including autophagy. PMID: 26643866
  37. HDAC6 may represent an optimal target for future immunosuppressant therapeutics with a particular role in transplantation. PMID: 27222932
  38. a combination regimen of bortezomib and the histone deacetylase inhibitor trichostatin A abolished HDAC6 activity and decreased autophagy induction while significantly enhancing bortezomib-induced apoptosis in HNSCC cells. PMID: 27369083
  39. this review highlights current data illustrating the complexity and importance of HDAC6 in viral pathogenesis. [review] PMID: 27959772
  40. Systemic lupus erythematosus patients had higher methylation in the HDAC6 promoter and lower HDAC6 mRNA expression than the controls. These changes may be related to the susceptibility of SLE. However, they are not associated with the disease activity of SLE. PMID: 26461065
  41. Cutaneous T-cell lymphoma (CTCL) pathogenesis remains unknown, and there are no curative therapies. Our findings not only demonstrate a critical role for IL15-mediated inflammation in cutaneous T-cell lymphomagenesis, but also uncover a new oncogenic regulatory loop in CTCL involving IL15, HDAC1, HDAC6, and miR-21 that shows differential sensitivity to isotype-specific HDAC inhibitors PMID: 27422033
  42. HDAC6 confers resistance to vemurafenib in BRAF-mutant melanoma cells. PMID: 28035401
  43. The inhibition of HDAC6 may be a promising strategy for the treatment of lung adenocarcinoma. PMID: 27221381
  44. Data show that expressions of histone deacetylase 6 protein (HDAC6) and c-myc protein are increased in fibroblasts transformed with activated K-ras protein. PMID: 26848526
  45. Overexpression of HDAC6 confers non-small cell lung cancer resistance to sorafenib. PMID: 27090797
  46. these data indicate that HDAC6, and acetylated alpha-tubulin, are important regulator of adipocyte differentiation. PMID: 26363102
  47. HDAC5 and HDAC6 were highly expressed in melanoma cells but exhibited low expression levels in normal skin cells. PMID: 26747087
  48. Study found that HDAC6 was significantly down-regulated in hepatocellular carcinoma cells (HCC) and the low expression of HDAC6 was closely associated with high recurrence rate of HCC patients with liver transplantation. PMID: 26086159
  49. results provide new mechanistic insights into the understanding that deacetylation of HSPA5 by HDAC6 facilitates GP78-mediated HSPA5 ubiquitination PMID: 26119938
  50. TGF-beta increased activity of HDAC6 without affecting its expression levels. PMID: 26763233

Show More

Hide All

Involvement in disease
Chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia (CDP-PBHM)
Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Perikaryon. Cell projection, dendrite. Cell projection, axon.
Protein Families
Histone deacetylase family, HD type 2 subfamily
Database Links

HGNC: 14064

OMIM: 300272

KEGG: hsa:10013

STRING: 9606.ENSP00000334061

UniGene: Hs.6764

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*